CN185249

Overview
NameCN185249
Unique NameCN185249
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length333
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2005 contig Csv1_Contig2005:289..621. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8B_ARATH (Autophagy-related protein 8b OS=Arabidopsis thaliana GN=ATG8B PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 8.577e-15
Identity = 38/50 (76.00%), Postives = 41/50 (82.00%), Query Frame = -3
Query:  182 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFG 331
            RIKL AEKAIF+FV N LPPT A+ SAIYEE KDEDGFLY+T SG N FG
Sbjct:   68 RIKLGAEKAIFVFVKNTLPPTAALMSAIYEEHKDEDGFLYMTYSGENTFG 117          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8_PHYIN (Autophagy-related protein 8 OS=Phytophthora infestans GN=ATG8 PE=3 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 2.495e-14
Identity = 37/50 (74.00%), Postives = 42/50 (84.00%), Query Frame = -3
Query:  182 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFG 331
            RIKLS EKAIFIF++NVLPPT A+ S IYEE+KD DGFLY+T SG N FG
Sbjct:   66 RIKLSPEKAIFIFINNVLPPTAALMSNIYEEQKDVDGFLYITYSGENTFG 115          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8_LACBI (Autophagy-related protein 8 OS=Laccaria bicolor GN=ATG8 PE=2 SV=2)

HSP 1 Score: 77.0258 bits (188), Expect = 3.259e-14
Identity = 38/50 (76.00%), Postives = 41/50 (82.00%), Query Frame = -3
Query:  182 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFG 331
            RIKL+ EKAIFIFVD VLPPT A+ SAIYEE KDED FLYV+ SG N FG
Sbjct:   67 RIKLAPEKAIFIFVDEVLPPTAALMSAIYEEHKDEDNFLYVSYSGENTFG 116          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8_USTMA (Autophagy-related protein 8 OS=Ustilago maydis GN=ATG8 PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 5.559e-14
Identity = 38/50 (76.00%), Postives = 41/50 (82.00%), Query Frame = -3
Query:  182 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFG 331
            RIKL+ EKAIFIFVD VLP T A+ SAIYEE KDEDGFLYV+ SG N FG
Sbjct:   67 RIKLAPEKAIFIFVDEVLPATAALMSAIYEEHKDEDGFLYVSYSGENTFG 116          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8_PICST (Autophagy-related protein 8 OS=Pichia stipitis GN=ATG8 PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 7.260e-14
Identity = 37/55 (67.27%), Postives = 43/55 (78.18%), Query Frame = -3
Query:  167 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFGSHIPV 331
            RIKL +EKAIFIFV+++LPPT A+ S IYEE KDEDGFLYV  SG N FG   P+
Sbjct:   67 RIKLPSEKAIFIFVNDILPPTAALISTIYEEHKDEDGFLYVLYSGENTFGQKKPL 121          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8_CANAL (Autophagy-related protein 8 OS=Candida albicans GN=ATG8 PE=3 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 9.483e-14
Identity = 36/55 (65.45%), Postives = 43/55 (78.18%), Query Frame = -3
Query:  167 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFGSHIPV 331
            RIKL +EKAIFIFV+++LPPT A+ S IYEE KDEDGFLYV  SG N FG  + +
Sbjct:   67 RIKLPSEKAIFIFVNDILPPTAALISTIYEEHKDEDGFLYVLYSGENTFGEKLAI 121          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8_PICPA (Autophagy-related protein 8 OS=Pichia pastoris GN=ATG8 PE=1 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.238e-13
Identity = 34/50 (68.00%), Postives = 41/50 (82.00%), Query Frame = -3
Query:  182 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFG 331
            RIK+ +EKAIFIF+D++LPPT A+ S +YEE KDEDGFLYV  SG N FG
Sbjct:   67 RIKIPSEKAIFIFIDDILPPTAALMSKVYEEHKDEDGFLYVLYSGENTFG 116          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8_DEBHA (Autophagy-related protein 8 OS=Debaryomyces hansenii GN=ATG8 PE=3 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 1.617e-13
Identity = 35/50 (70.00%), Postives = 41/50 (82.00%), Query Frame = -3
Query:  182 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFG 331
            RIKL +EKAIFIF++++LPPT A+ S IYEE KDEDGFLYV  SG N FG
Sbjct:   67 RIKLPSEKAIFIFINDILPPTAALMSTIYEEHKDEDGFLYVLYSGENTFG 116          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8_MAGGR (Autophagy-related protein 8 OS=Magnaporthe grisea GN=ATG8 PE=3 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 2.759e-13
Identity = 36/50 (72.00%), Postives = 40/50 (80.00%), Query Frame = -3
Query:  182 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFG 331
            RIKLS EKAIFIFV + LPPT A+ S+IYE  KDEDGFLY+T SG N FG
Sbjct:   67 RIKLSPEKAIFIFVQDTLPPTAALMSSIYELHKDEDGFLYITYSGENTFG 116          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8_VANPO (Autophagy-related protein 8 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG8 PE=3 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 4.706e-13
Identity = 35/51 (68.63%), Postives = 41/51 (80.39%), Query Frame = -3
Query:  179 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFGS 331
            RI L  EKAIFIFV++ LPPT A+ SA+Y+E KD+DGFLYVT SG N FGS
Sbjct:   67 RIMLPPEKAIFIFVNDTLPPTAALMSAVYQEHKDKDGFLYVTYSGENTFGS 117          
The following BLAST results are available for this feature:
BLAST of CN185249 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 49
Match NameE-valueIdentityDescription
ATG8B_ARATH8.577e-1576.00Autophagy-related protein 8b OS=Arabidopsis thalia... [more]
ATG8_PHYIN2.495e-1474.00Autophagy-related protein 8 OS=Phytophthora infest... [more]
ATG8_LACBI3.259e-1476.00Autophagy-related protein 8 OS=Laccaria bicolor GN... [more]
ATG8_USTMA5.559e-1476.00Autophagy-related protein 8 OS=Ustilago maydis GN=... [more]
ATG8_PICST7.260e-1467.27Autophagy-related protein 8 OS=Pichia stipitis GN=... [more]
ATG8_CANAL9.483e-1465.45Autophagy-related protein 8 OS=Candida albicans GN... [more]
ATG8_PICPA1.238e-1368.00Autophagy-related protein 8 OS=Pichia pastoris GN=... [more]
ATG8_DEBHA1.617e-1370.00Autophagy-related protein 8 OS=Debaryomyces hansen... [more]
ATG8_MAGGR2.759e-1372.00Autophagy-related protein 8 OS=Magnaporthe grisea ... [more]
ATG8_VANPO4.706e-1368.63Autophagy-related protein 8 OS=Vanderwaltozyma pol... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001A19_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001A19, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185249 ID=CN185249|Name=CN185249|organism=Citrus sinensis|type=EST|length=333bp
CTTATATCCAATAGGTAACTGTACATATTATCACTGGCAATGTCTTTATA
AAATATAAAATATGCCCGATAAAGGAATATTCAGCGGAAAGCAAGGATGA
CAATTGAGATAAAAATGCCGTCGCCCCAAAAACCACTCAATGAGCGGATA
GATAATCACAAGGCTAAACTGGGATGTGGCTTCCAAATGGGTTCCCCCCA
CTGGGAGTCACATAAAGAAAACCATCTTCATCCTTTTTCTCTTCGTATAT
GGCAGACCTAATTGCACCGGTAGGTGGGAGCACATTATCCACAAAAATAA
ATATCGCCTTTTCAGCACTCAGTTTGATCCTTT
back to top