CN185249

Overview
NameCN185249
Unique NameCN185249
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length333
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2005 contig Csv1_Contig2005:289..621. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8_LODEL (Autophagy-related protein 8 OS=Lodderomyces elongisporus GN=ATG8 PE=3 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 4.706e-13
Identity = 35/50 (70.00%), Postives = 41/50 (82.00%), Query Frame = -3
Query:  182 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFG 331
            RIKL +EKAIFIFV+++LPPT A+ S IYEE KD+DGFLYV  SG N FG
Sbjct:   67 RIKLPSEKAIFIFVNDILPPTAALISTIYEEHKDDDGFLYVLYSGENTFG 116          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8_CRYNE (Autophagy-related protein 8 OS=Cryptococcus neoformans GN=ATG8 PE=3 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 6.146e-13
Identity = 34/50 (68.00%), Postives = 41/50 (82.00%), Query Frame = -3
Query:  182 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFG 331
            RIKL+ EKAIFIFVD++LPPT A+ S+IY+E KDEDGFLYV  +  N FG
Sbjct:   68 RIKLAPEKAIFIFVDDILPPTAALMSSIYDEHKDEDGFLYVLYASENTFG 117          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8_ASHGO (Autophagy-related protein 8 OS=Ashbya gossypii GN=ATG8 PE=3 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 6.146e-13
Identity = 35/51 (68.63%), Postives = 41/51 (80.39%), Query Frame = -3
Query:  179 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFGS 331
            RIKL AEKAIFIFV++ LPPT A+  A+Y+E KD+DGFLYV  SG N FGS
Sbjct:   66 RIKLPAEKAIFIFVNDTLPPTAALMFAVYQEHKDKDGFLYVKYSGENTFGS 116          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8_YEAST (Autophagy-related protein 8 OS=Saccharomyces cerevisiae GN=ATG8 PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.048e-12
Identity = 35/50 (70.00%), Postives = 40/50 (80.00%), Query Frame = -3
Query:  182 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFG 331
            RI L  EKAIFIFV++ LPPT A+ SAIY+E KD+DGFLYVT SG N FG
Sbjct:   67 RIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFG 116          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8_YEAS7 (Autophagy-related protein 8 OS=Saccharomyces cerevisiae (strain YJM789) GN=ATG8 PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.048e-12
Identity = 35/50 (70.00%), Postives = 40/50 (80.00%), Query Frame = -3
Query:  182 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFG 331
            RI L  EKAIFIFV++ LPPT A+ SAIY+E KD+DGFLYVT SG N FG
Sbjct:   67 RIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFG 116          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8_DICDI (Autophagy-related protein 8 OS=Dictyostelium discoideum GN=atg8 PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.048e-12
Identity = 33/51 (64.71%), Postives = 41/51 (80.39%), Query Frame = -3
Query:  173 KLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFGSHI 325
            K+SAEKAI++FV+N +PPT A+ S IYE  KDEDGFLY+T SG N FGS +
Sbjct:   72 KVSAEKAIYLFVNNTIPPTAALISQIYERYKDEDGFLYITYSGENTFGSDL 122          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8_PICAN (Autophagy-related protein 8 OS=Pichia angusta GN=ATG8 PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 3.050e-12
Identity = 32/50 (64.00%), Postives = 41/50 (82.00%), Query Frame = -3
Query:  182 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFG 331
            RI+L +EKAIFIFV+++LPPT ++ S IYE+ KDEDGFLY+  SG N FG
Sbjct:   67 RIQLPSEKAIFIFVNDILPPTASLMSTIYEQYKDEDGFLYILYSGENTFG 116          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8_KLULA (Autophagy-related protein 8 OS=Kluyveromyces lactis GN=ATG8 PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 3.984e-12
Identity = 33/50 (66.00%), Postives = 41/50 (82.00%), Query Frame = -3
Query:  182 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFG 331
            RIKL AEKAIFIFV++ LPPT A+ S+IY++ KD+DGFLYV+ S  N FG
Sbjct:   67 RIKLPAEKAIFIFVNDTLPPTAALMSSIYQQHKDKDGFLYVSYSSENTFG 116          
BLAST of CN185249 vs. ExPASy Swiss-Prot
Match: ATG8_CANGA (Autophagy-related protein 8 OS=Candida glabrata GN=ATG8 PE=3 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.159e-11
Identity = 32/50 (64.00%), Postives = 39/50 (78.00%), Query Frame = -3
Query:  182 RIKLSAEKAIFIFVDNVLPPTGAIRSAIYEEKKDEDGFLYVTPSGGNPFG 331
            RI L  EKAIFIFV++ LPPT ++ S +Y+E KD+DGFLYVT SG N FG
Sbjct:   67 RIMLPPEKAIFIFVNDTLPPTASLMSQVYQEHKDKDGFLYVTYSGENTFG 116          
The following BLAST results are available for this feature:
BLAST of CN185249 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 49
Match NameE-valueIdentityDescription
ATG8_LODEL4.706e-1370.00Autophagy-related protein 8 OS=Lodderomyces elongi... [more]
ATG8_CRYNE6.146e-1368.00Autophagy-related protein 8 OS=Cryptococcus neofor... [more]
ATG8_ASHGO6.146e-1368.63Autophagy-related protein 8 OS=Ashbya gossypii GN=... [more]
ATG8_YEAST1.048e-1270.00Autophagy-related protein 8 OS=Saccharomyces cerev... [more]
ATG8_YEAS71.048e-1270.00Autophagy-related protein 8 OS=Saccharomyces cerev... [more]
ATG8_DICDI1.048e-1264.71Autophagy-related protein 8 OS=Dictyostelium disco... [more]
ATG8_PICAN3.050e-1264.00Autophagy-related protein 8 OS=Pichia angusta GN=A... [more]
ATG8_KLULA3.984e-1266.00Autophagy-related protein 8 OS=Kluyveromyces lacti... [more]
ATG8_CANGA1.159e-1164.00Autophagy-related protein 8 OS=Candida glabrata GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0001A19_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0001A19, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN185249 ID=CN185249|Name=CN185249|organism=Citrus sinensis|type=EST|length=333bp
CTTATATCCAATAGGTAACTGTACATATTATCACTGGCAATGTCTTTATA
AAATATAAAATATGCCCGATAAAGGAATATTCAGCGGAAAGCAAGGATGA
CAATTGAGATAAAAATGCCGTCGCCCCAAAAACCACTCAATGAGCGGATA
GATAATCACAAGGCTAAACTGGGATGTGGCTTCCAAATGGGTTCCCCCCA
CTGGGAGTCACATAAAGAAAACCATCTTCATCCTTTTTCTCTTCGTATAT
GGCAGACCTAATTGCACCGGTAGGTGGGAGCACATTATCCACAAAAATAA
ATATCGCCTTTTCAGCACTCAGTTTGATCCTTT
back to top