CN185005
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CN185005 vs. ExPASy Swiss-Prot
Match: KTNB1_HUMAN (Katanin p80 WD40-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1) HSP 1 Score: 58.151 bits (139), Expect = 9.567e-11 Identity = 31/99 (31.31%), Postives = 55/99 (55.56%), Query Frame = -1 Query: 318 IVSASWDRTVKVWNLSNCKLRATLAGHTGYVNTVAVSPDGSLCASGGKDGVILLWDLAEGKRLYSLDA-GAVIHALCFSPNRYWLCAATEQSIKIWDLE 611 + SA+ D TVK+W+L+ K+ + GHTG VN V P+ L ASG D I WDL + + + ++ + ++ F+P+ L + + S++++ E Sbjct: 162 LASAADDHTVKLWDLTAGKMMSEFPGHTGPVNVVEFHPNEYLLASGSSDRTIRFWDLEKFQVVSCIEGEPGPVRSVLFNPDGCCLYSGCQDSLRVYGWE 260 HSP 2 Score: 29.261 bits (64), Expect = 9.567e-11 Identity = 15/41 (36.59%), Postives = 24/41 (58.54%), Query Frame = -3 Query: 631 IVSASRDCTIKLWNTLGE-CKYTIQEGDAHTEWVSCVRFSP 750 + S S+D IKLW+ + C + + H++ V C+RFSP Sbjct: 120 VASGSQDTNIKLWDIRRKGCVFRYR---GHSQAVRCLRFSP 157 The following BLAST results are available for this feature:
BLAST of CN185005 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 61
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CN185005 ID=CN185005; Name=CN185005; organism=Citrus sinensis; type=EST; length=758bpback to top |