CN184542
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CN184542 vs. ExPASy Swiss-Prot
Match: NEK4_ORYSJ (Serine/threonine-protein kinase Nek4 OS=Oryza sativa subsp. japonica GN=NEK4 PE=2 SV=1) HSP 1 Score: 80.1073 bits (196), Expect = 9.800e-15 Identity = 37/68 (54.41%), Postives = 49/68 (72.06%), Query Frame = -1 Query: 372 RNSSDARRHRFDTSSYQQRAEALEGLLEFSAKLLQQERYDELGVLLKPFGPGKVSPRETAIWLTKSIK 575 + + + D +S++QRAEALEGLLE SA LL+ R +EL ++L+PFG KVSPRETAIWL +S K Sbjct: 864 KEEASPAKEALDVTSFRQRAEALEGLLELSADLLENNRLEELAIVLQPFGKNKVSPRETAIWLARSFK 931
BLAST of CN184542 vs. ExPASy Swiss-Prot
Match: NEK6_ORYSJ (Serine/threonine-protein kinase Nek6 OS=Oryza sativa subsp. japonica GN=NEK6 PE=2 SV=2) HSP 1 Score: 72.7886 bits (177), Expect = 1.565e-12 Identity = 36/51 (70.59%), Postives = 42/51 (82.35%), Query Frame = -1 Query: 375 QQRAEALEGLLEFSAKLLQQERYDELGVLLKPFGPGKVSPRETAIWLTKSI 527 QQRA+ALE LLE AKLL+QER +EL +L+PFG G VS RETAIWLTKS+ Sbjct: 471 QQRADALESLLELCAKLLKQERLEELAGVLRPFGEGAVSSRETAIWLTKSL 521
BLAST of CN184542 vs. ExPASy Swiss-Prot
Match: NEK6_ARATH (Serine/threonine-protein kinase Nek6 OS=Arabidopsis thaliana GN=NEK6 PE=2 SV=1) HSP 1 Score: 72.4034 bits (176), Expect = 2.043e-12 Identity = 37/60 (61.67%), Postives = 45/60 (75.00%), Query Frame = -1 Query: 348 QQRAEALEGLLEFSAKLLQQERYDELGVLLKPFGPGKVSPRETAIWLTKSIKENTAKQDD 527 ++RAEALE LLE A LL+QE++DEL +LKPFG VS RETAIWLTKS+ KQ+D Sbjct: 352 EERAEALESLLELCAGLLRQEKFDELEGVLKPFGDETVSSRETAIWLTKSLMNVKRKQND 411 The following BLAST results are available for this feature:
BLAST of CN184542 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 13
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CN184542 ID=CN184542; Name=CN184542; organism=Citrus sinensis; type=EST; length=617bpback to top |