FC921881
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC921881 vs. ExPASy Swiss-Prot
Match: FLS_MATIN (Flavonol synthase/flavanone 3-hydroxylase (Fragment) OS=Matthiola incana PE=2 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 3.339e-11 Identity = 29/69 (42.03%), Postives = 46/69 (66.67%), Query Frame = 3 Query: 6 VSNYPPCPKPDLIKGLRAHTDAGGIILLFQDDKVSGLQLLKDGQWIDVPPLRHSIVVNLGDQIEVITNG 212 +++YPP P D GL HTD G+ L+ ++ + GLQ+ KD WI+V + +I+VN+GDQI +++NG Sbjct: 157 INHYPPYPHSDSFNGLEPHTDINGLTLIITNE-IPGLQVFKDDHWIEVEYIPSAIIVNIGDQIMMLSNG 224
BLAST of FC921881 vs. ExPASy Swiss-Prot
Match: ACCH2_ARATH (1-aminocyclopropane-1-carboxylate oxidase homolog 2 OS=Arabidopsis thaliana GN=At1g06640 PE=2 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 4.361e-11 Identity = 26/65 (40.00%), Postives = 44/65 (67.69%), Query Frame = 3 Query: 15 YPPCPKPDLIKGLRAHTDAGGIILLFQDDKVSGLQLLKDGQWIDVPPLRHSIVVNLGDQIEVITN 209 +PPCP+PDL G H+D G + + D + GLQ+ ++G W DVP + ++++N+GD +++ITN Sbjct: 226 FPPCPEPDLTFGTSKHSD-GSFLTVLLPDNIEGLQVCREGYWFDVPHVPGALIINIGDLLQLITN 289
BLAST of FC921881 vs. ExPASy Swiss-Prot
Match: G3OX1_ARATH (Gibberellin 3-beta-dioxygenase 1 OS=Arabidopsis thaliana GN=GA4 PE=1 SV=2) HSP 1 Score: 66.2402 bits (160), Expect = 5.695e-11 Identity = 30/71 (42.25%), Postives = 50/71 (70.42%), Query Frame = 3 Query: 3 KVSNYPPCPKPDLIKGLRAHTDAGGIILLFQDDKVSGLQLLKDG-QWIDVPPLRHSIVVNLGDQIEVITNG 212 ++++YP CP+PD GL AHTD+ + +L+Q++ +GLQ+ +D W+ VPP S+VVN+GD +++NG Sbjct: 213 QLNHYPVCPEPDRAMGLAAHTDSTLLTILYQNN-TAGLQVFRDDLGWVTVPPFPGSLVVNVGDLFHILSNG 282
BLAST of FC921881 vs. ExPASy Swiss-Prot
Match: LDOX_VITVI (Leucoanthocyanidin dioxygenase OS=Vitis vinifera PE=2 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 7.438e-11 Identity = 27/70 (38.57%), Postives = 47/70 (67.14%), Query Frame = 3 Query: 3 KVSNYPPCPKPDLIKGLRAHTDAGGIILLFQDDKVSGLQLLKDGQWIDVPPLRHSIVVNLGDQIEVITNG 212 K++ YP CP+P+L G+ AHTD + + + V GLQL +G+W+ + +SI++++GD IE+++NG Sbjct: 219 KINYYPKCPQPELALGVEAHTDVSALTFILHN-MVPGLQLFYEGKWVTAKCVPNSIIMHIGDTIEILSNG 287
BLAST of FC921881 vs. ExPASy Swiss-Prot
Match: LDOX_MALDO (Leucoanthocyanidin dioxygenase OS=Malus domestica GN=ANS PE=2 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.715e-11 Identity = 27/70 (38.57%), Postives = 47/70 (67.14%), Query Frame = 3 Query: 3 KVSNYPPCPKPDLIKGLRAHTDAGGIILLFQDDKVSGLQLLKDGQWIDVPPLRHSIVVNLGDQIEVITNG 212 K++ YP CP+P+L G+ AHTD + + + V GLQL +G+W+ + +SIV+++GD +E+++NG Sbjct: 217 KINYYPKCPQPELALGVEAHTDVSALTFILHN-MVPGLQLFYEGKWVTAKCVPNSIVMHIGDTLEILSNG 285 The following BLAST results are available for this feature:
BLAST of FC921881 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 55
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC921881 ID=FC921881; Name=FC921881; organism=Citrus sinensis; type=EST; length=214bpback to top |