EG358201
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EG358201 vs. ExPASy Swiss-Prot
Match: DNAJ_BACTR (Chaperone protein dnaJ OS=Bacillus thermoglucosidasius GN=dnaJ PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 4.335e-11 Identity = 38/96 (39.58%), Postives = 50/96 (52.08%), Query Frame = 2 Query: 2 RKSYRKLSLKVHPDKNKAPGAEEAFKAVSKAFQCLSNDESRKKYDITGSDEPVYQPRTHTRAARGFNGFYDSDID---------AEEIFRNFFFGG 262 +K+YRKLS K HPD NK P A E FK + +A++ LS+D+ R YD G +P +GF GF D D ++IF FF GG Sbjct: 22 KKAYRKLSKKYHPDINKEPDAAEKFKEIKEAYEVLSDDQKRAHYDQFGHADP----------NQGFGGFRSDDFDFGGFSGFSGFDDIFSTFFGGG 107
BLAST of EG358201 vs. ExPASy Swiss-Prot
Match: DNAJ_CAMLR (Chaperone protein dnaJ OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=dnaJ PE=3 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 9.657e-11 Identity = 39/88 (44.32%), Postives = 53/88 (60.23%), Query Frame = 2 Query: 2 RKSYRKLSLKVHPDKNKAPG-AEEAFKAVSKAFQCLSNDESRKKYDITGSDEPVYQPRTHTRAARGFNGFYDSDIDAEEIFRNFFFGG 262 +K+YRK++LK HPD+N+ AEE FK V++A++ LSNDE R YD G + Q A GF GF D+D +IF +FF G Sbjct: 21 KKAYRKMALKYHPDRNQGDKEAEEKFKLVNEAYEVLSNDEKRSIYDRYGKEGLKGQ-------AGGFGGF--GDVDLGDIFSSFFGDG 99 The following BLAST results are available for this feature:
BLAST of EG358201 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 42
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EG358201 ID=EG358201; Name=EG358201; organism=Citrus sinensis; type=EST; length=460bpback to top |