CN188884

Overview
NameCN188884
Unique NameCN188884
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length765
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CN188884_ssr99 microsatellite CN188884_ssr99:99..110. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig2689 contig Csv1_Contig2689:1..766. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_PROM3 (50S ribosomal protein L1 OS=Prochlorococcus marinus (strain MIT 9303) GN=rplA PE=3 SV=2)

HSP 1 Score: 179.874 bits (455), Expect = 1.366e-44
Identity = 86/140 (61.43%), Postives = 108/140 (77.14%), Query Frame = -1
Query:  346 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLD 765
            A+L G DDL+E I  G M+FD LIA+PDMM KVA LG++LGPRGLMPNPKAGTVTT++  AI+EFK GK+E+RAD+ GIVH+ FGKA FS D LL N     ++I+ NKP GAKG YWKS YI S+MGPS+ +++  + D
Sbjct:   91 AELAGDDDLVESIGKGQMDFDLLIATPDMMPKVAKLGRVLGPRGLMPNPKAGTVTTDLAAAIKEFKAGKLEFRADRAGIVHVRFGKASFSADALLENLKTLQETIDRNKPSGAKGRYWKSLYITSTMGPSVEVDVTALQD 230          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_SYNSC (50S ribosomal protein L1 OS=Synechococcus sp. (strain CC9605) GN=rplA PE=3 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.784e-44
Identity = 85/140 (60.71%), Postives = 108/140 (77.14%), Query Frame = -1
Query:  346 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLD 765
            A+L G +DL+E I  G M+FD LIA+PDMM KVA LG++LGPRGLMPNPKAGTVTT++  AI+EFK GK+E+RAD+TGIVH+ FGKA FS D LL N     ++I+ NKP GAKG YWKS Y+ S+MGPS+ ++   + D
Sbjct:   91 AELAGEEDLVESISKGEMDFDLLIATPDMMPKVAKLGRVLGPRGLMPNPKAGTVTTDLEAAIKEFKAGKLEFRADRTGIVHVRFGKASFSADALLQNLKTLQETIDRNKPSGAKGRYWKSLYVTSTMGPSVEVDFSALQD 230          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_SYNE7 (50S ribosomal protein L1 OS=Synechococcus elongatus (strain PCC 7942) GN=rplA PE=3 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.784e-44
Identity = 84/143 (58.74%), Postives = 112/143 (78.32%), Query Frame = -1
Query:  337 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLDYKL 765
            AD+ G ++LIE+I  GF++FD LIA+PD+M +VA LG+ LGPRGLMP+PK GTVT ++ QAI EFK GK+E+RAD+TGIVH+ FGKA FS DDLL N  A  ++I+ N+P GAKG YW+S YI ++MGP+I ++I  + D KL
Sbjct:   92 ADIAGSEELIEEISKGFLDFDLLIATPDVMPQVAKLGRQLGPRGLMPSPKGGTVTFDLEQAINEFKAGKLEFRADRTGIVHVLFGKASFSADDLLANLKALQETIDRNRPSGAKGRYWRSVYISATMGPAIEVDINALRDLKL 234          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_SYNY3 (50S ribosomal protein L1 OS=Synechocystis sp. (strain PCC 6803) GN=rplA PE=3 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 2.331e-44
Identity = 83/146 (56.85%), Postives = 111/146 (76.03%), Query Frame = -1
Query:  328 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLDYKLPSN 765
            AD+ G ++LIE+I+ G M+FD LIA+PDMM K+A LGK LGPRGLMP+PK GTVT ++  A+ EFK GK+E+RAD+TGIVH+ FGKA FS DDLL N  A  ++I+ N+P GAKG +W++ ++ SSMGPSI ++I  + D K   N
Sbjct:   93 ADIAGSEELIEEIQKGMMDFDVLIATPDMMPKIARLGKQLGPRGLMPSPKGGTVTADLAAAVNEFKAGKLEFRADRTGIVHVMFGKASFSADDLLANLKALQETIDRNRPSGAKGRFWRTVFVSSSMGPSIPVDINALRDLKFEDN 238          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_TRIEI (50S ribosomal protein L1 OS=Trichodesmium erythraeum (strain IMS101) GN=rplA PE=3 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 3.044e-44
Identity = 81/143 (56.64%), Postives = 113/143 (79.02%), Query Frame = -1
Query:  337 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLDYKL 765
            ADL G ++LIEQI  G MEFD+LIA+PD+M +VA LG++LGPRGLMP+PK GTVT ++ +AI+EFK GK+E+RAD++GIVH+ FGK  FS +DLLIN  A  + I+ N+P GAKG YW++ ++ ++MGPSI +++  + D KL
Sbjct:   92 ADLAGSEELIEQISKGMMEFDRLIATPDVMPQVAKLGRLLGPRGLMPSPKGGTVTFDLTKAIDEFKAGKLEFRADRSGIVHVMFGKTSFSVEDLLINLKALQECIDRNRPSGAKGRYWRTIFVSATMGPSIEIDVSSLQDLKL 234          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_SYNP6 (50S ribosomal protein L1 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rplA PE=3 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 3.975e-44
Identity = 83/143 (58.04%), Postives = 112/143 (78.32%), Query Frame = -1
Query:  337 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLDYKL 765
            AD+ G ++LIE+I  GF++FD LIA+PD+M +VA LG+ LGPRGLMP+PK GTVT ++ QA+ EFK GK+E+RAD+TGIVH+ FGKA FS DDLL N  A  ++I+ N+P GAKG YW+S YI ++MGP+I ++I  + D KL
Sbjct:   92 ADIAGSEELIEEISKGFLDFDLLIATPDVMPQVAKLGRQLGPRGLMPSPKGGTVTFDLEQAVNEFKAGKLEFRADRTGIVHVLFGKASFSADDLLANLKALQETIDRNRPSGAKGRYWRSVYISATMGPAIEVDINALRDPKL 234          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_PROMT (50S ribosomal protein L1 OS=Prochlorococcus marinus (strain NATL2A) GN=rplA PE=3 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 5.192e-44
Identity = 85/140 (60.71%), Postives = 108/140 (77.14%), Query Frame = -1
Query:  346 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLD 765
            ADL G +DL++ I  G M FD LI++PDMM KVA LG++LGPRGLMPNPKAGTVTT++  AI+EFK GK+E+RADK GIVH+ FGKA FSE+ LL N      +IE NKP GAKG +W+S +I S+MGPS+ ++I E+ D
Sbjct:   91 ADLAGEEDLVDSINKGEMNFDLLISTPDMMPKVAKLGRVLGPRGLMPNPKAGTVTTDLEGAIKEFKAGKLEFRADKAGIVHVRFGKASFSEEALLENLKTLQTTIEKNKPSGAKGKFWRSFFITSTMGPSVEVDINELQD 230          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_PROM1 (50S ribosomal protein L1 OS=Prochlorococcus marinus (strain NATL1A) GN=rplA PE=3 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 5.192e-44
Identity = 85/140 (60.71%), Postives = 108/140 (77.14%), Query Frame = -1
Query:  346 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLD 765
            ADL G +DL++ I  G M FD LI++PDMM KVA LG++LGPRGLMPNPKAGTVTT++  AI+EFK GK+E+RADK GIVH+ FGKA FSE+ LL N      +IE NKP GAKG +W+S +I S+MGPS+ ++I E+ D
Sbjct:   91 ADLAGEEDLVDSINKGEMNFDLLISTPDMMPKVAKLGRVLGPRGLMPNPKAGTVTTDLEGAIKEFKAGKLEFRADKAGIVHVRFGKASFSEEALLENLKTLQTTIEKNKPSGAKGKFWRSFFITSTMGPSVEVDINELQD 230          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_CYAP8 (50S ribosomal protein L1 OS=Cyanothece sp. (strain PCC 8801) GN=rplA PE=3 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 5.192e-44
Identity = 82/143 (57.34%), Postives = 112/143 (78.32%), Query Frame = -1
Query:  337 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLDYKL 765
            AD+VG ++LIE+I  G M+F+ LIA+PDMM KVA LG++LGPRGLMP+PK GTVT ++  AI EFK GK+E+RAD+TGIVH+ FGKA F+ +DLL N  A  ++++ N+P GAKG YW+S ++ +SMGPSI ++I  + D KL
Sbjct:   93 ADIVGSEELIEEIFKGMMDFEVLIATPDMMPKVAKLGRLLGPRGLMPSPKGGTVTADLTNAITEFKAGKLEFRADRTGIVHVMFGKASFTPEDLLANLKALQETVDRNRPSGAKGRYWRSVFVSASMGPSIAVDINALRDLKL 235          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_PROMA (50S ribosomal protein L1 OS=Prochlorococcus marinus GN=rplA PE=3 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 6.781e-44
Identity = 85/142 (59.86%), Postives = 109/142 (76.76%), Query Frame = -1
Query:  340 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLDYK 765
            ADL G ++LI+ I  G M FD LI++PDMM KVA LG++LGPRGLMPNPKAGTVTT++  +I+EFK GK+E+RAD+ GIVH+ FGKA FS +DLL N     ++I+ NKP GAKG YWKS YI S+MGPS+ ++I  + D K
Sbjct:   91 ADLAGEEELIDSISKGEMNFDLLISTPDMMPKVAKLGRVLGPRGLMPNPKAGTVTTDLISSIKEFKAGKLEFRADRAGIVHVRFGKASFSPEDLLENLKVLHEAIDRNKPSGAKGRYWKSLYITSTMGPSVEIDIAALQDSK 232          
The following BLAST results are available for this feature:
BLAST of CN188884 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RL1_PROM31.366e-4461.4350S ribosomal protein L1 OS=Prochlorococcus marinu... [more]
RL1_SYNSC1.784e-4460.7150S ribosomal protein L1 OS=Synechococcus sp. (str... [more]
RL1_SYNE71.784e-4458.7450S ribosomal protein L1 OS=Synechococcus elongatu... [more]
RL1_SYNY32.331e-4456.8550S ribosomal protein L1 OS=Synechocystis sp. (str... [more]
RL1_TRIEI3.044e-4456.6450S ribosomal protein L1 OS=Trichodesmium erythrae... [more]
RL1_SYNP63.975e-4458.0450S ribosomal protein L1 OS=Synechococcus sp. (str... [more]
RL1_PROMT5.192e-4460.7150S ribosomal protein L1 OS=Prochlorococcus marinu... [more]
RL1_PROM15.192e-4460.7150S ribosomal protein L1 OS=Prochlorococcus marinu... [more]
RL1_CYAP85.192e-4457.3450S ribosomal protein L1 OS=Cyanothece sp. (strain... [more]
RL1_PROMA6.781e-4459.8650S ribosomal protein L1 OS=Prochlorococcus marinu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0006P10_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0006P10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188884 ID=CN188884|Name=CN188884|organism=Citrus sinensis|type=EST|length=765bp
TTTTTTTTTTTTTTTTTACAAGAATGGAAAAATATTCAGTAGCCATTCAA
GTAATTTTACAGAAAAAAAAATTGCGGTAATGAACCTGAGAGTGGGCGAT
AATAATAATATCTTTTTCAGTACGGAAAAAAGCCATGCTGTATGCATTTT
TCCTTTTTTTTATTTGCTACAATCTCATCCACATTGATAATCAAGATCTC
CTCACCTCACCATAATTCACTCTCCTACAACTTTTGCCAAGCAGTGGCAA
GCCCTGGCATGGGTATCAAAGAGGCTGACTGAACAGTTAAAGCTATCATT
TACAAAATTTAGTTATGTCATTTAGAAATTTGATGGAAGCTTGTAATCGA
GCATTTCTTTTATGTTTAATCGAATGGAAGGTCCCATTGATGAGCAAATG
TAAGCACTTTTCCAGTACACTCCTTTGGCCCCTTTTGGCTTGTTTGCTTC
AATTGATTTAACAGCAGCAAGGAAGTTTATGAGGAGGTCATCTTCAGAAA
AATCAGCTTTCCCAAAAGGTATGTGGACAATCCCAGTTTTATCTGCTCTA
TATTCAACTTTTCCCTTCTTGAATTCTTCTATGGCCTGAGGTATGTTAGT
TGTAACAGTACCAGCTTTAGGATTTGGCATGAGTCCCCGTGGTCCAAGAA
TTTTTCCTAGGCTGGCAACCTTAACCATCATATCTGGTGAAGCAATTAGC
TTGTCGAACTCCATGAATCCTCCTTTTATTTGTTCAATCAAGTCATCACC
ACCAACCAAATCTGC
back to top