CN188884

Overview
NameCN188884
Unique NameCN188884
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length765
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CN188884_ssr99 microsatellite CN188884_ssr99:99..110. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig2689 contig Csv1_Contig2689:1..766. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_THESQ (50S ribosomal protein L1 OS=Thermotoga sp. (strain RQ2) GN=rplA PE=3 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 4.257e-38
Identity = 76/140 (54.29%), Postives = 102/140 (72.86%), Query Frame = -1
Query:  349 ADLVGGDDLIEQI-KGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEML 765
            AD VG +DL+E+I K GF++FD  IA+PDMM  +  LGKILGPRGLMP+PK+GTVT  + +A++EFKKG++E R DKTG +HIP GK  F  + L  N +AA+K I   KP G KG + K A + S+MGP I+LN++ +L
Sbjct:   92 ADYVGAEDLVEKIEKEGFLDFDVAIATPDMMRIIGRLGKILGPRGLMPSPKSGTVTQEVAEAVKEFKKGRIEVRTDKTGNIHIPVGKRSFDNEKLKENIIAAIKQIMQMKPAGVKGQFIKKAVLSSTMGPGIKLNLQSLL 231          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_DICTD (50S ribosomal protein L1 OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=rplA PE=3 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 7.262e-38
Identity = 77/143 (53.85%), Postives = 107/143 (74.83%), Query Frame = -1
Query:  346 ADLVGGDDLIEQIKGGFMEFDKLIASPDMM--VKVAS-LGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLD 765
            AD VGG+DL++QI+ G+++FD  IA+PD+M  +K+ S LGKILGPRGLMPNPK GTVT +I +A++E+K G+VE+R D+ GIVH+P GKA FSE+ L  N +  + ++   KP  AKG Y+KS YI  SMGPS+ ++ K + D
Sbjct:   92 ADYVGGEDLVKQIESGWLDFDVAIATPDIMGTLKIPSRLGKILGPRGLMPNPKTGTVTNDIAKAVKEYKAGRVEFRTDRYGIVHVPIGKASFSEEALYKNLMTVLGTLLRLKPAAAKGQYFKSIYISPSMGPSVPIDTKNIAD 234          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_DICT6 (50S ribosomal protein L1 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=rplA PE=3 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 7.262e-38
Identity = 77/143 (53.85%), Postives = 107/143 (74.83%), Query Frame = -1
Query:  346 ADLVGGDDLIEQIKGGFMEFDKLIASPDMM--VKVAS-LGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLD 765
            AD VGG+DL++QI+ G+++FD  IA+PD+M  +K+ S LGKILGPRGLMPNPK GTVT +I +A++E+K G+VE+R D+ GIVH+P GKA FSE+ L  N +  + ++   KP  AKG Y+KS YI  SMGPS+ ++ K + D
Sbjct:   92 ADYVGGEDLVKQIESGWLDFDVAIATPDIMGTLKIPSRLGKILGPRGLMPNPKTGTVTNDIAKAVKEYKAGRVEFRTDRYGIVHVPIGKASFSEEALYKNLMTVLGTLLRLKPAAAKGQYFKSIYISPSMGPSVPIDTKNIAD 234          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_THENN (50S ribosomal protein L1 OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=rplA PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 9.484e-38
Identity = 74/141 (52.48%), Postives = 103/141 (73.05%), Query Frame = -1
Query:  346 ADLVGGDDLIEQI-KGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLD 765
            AD VG +DL+E+I K GF++FD  IA+PDMM  +  LGKILGPRGLMP+PK+GTVT  + +A++EFKKG++E R DKTG +HIP GK  F  + +  N ++A+K I   KP G KG + K A + S+MGP I+LN++ +L+
Sbjct:   92 ADYVGAEDLVEKIEKEGFLDFDVAIATPDMMRVIGRLGKILGPRGLMPSPKSGTVTNEVAEAVKEFKKGRIEVRTDKTGNIHIPVGKKSFDNEKIKENVISAIKQIMQMKPAGVKGQFIKKAVLASTMGPGIKLNLQSILN 232          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_THEMA (50S ribosomal protein L1 OS=Thermotoga maritima GN=rplA PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 9.484e-38
Identity = 75/140 (53.57%), Postives = 101/140 (72.14%), Query Frame = -1
Query:  349 ADLVGGDDLIEQI-KGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEML 765
            AD VG +DL+E+I K GF++FD  IA+PDMM  +  LGKILGPRGLMP+PK+GTVT  + +A++EFKKG++E R DKTG +HIP GK  F  + L  N +AA+K I   KP G KG + K   + S+MGP I+LN++ +L
Sbjct:   92 ADYVGAEDLVEKIEKEGFLDFDVAIATPDMMRIIGRLGKILGPRGLMPSPKSGTVTQEVAEAVKEFKKGRIEVRTDKTGNIHIPVGKRSFDNEKLKENIIAAIKQIMQMKPAGVKGQFIKKVVLASTMGPGIKLNLQSLL 231          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_PHEZH (50S ribosomal protein L1 OS=Phenylobacterium zucineum (strain HLK1) GN=rplA PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 9.484e-38
Identity = 70/138 (50.72%), Postives = 100/138 (72.46%), Query Frame = -1
Query:  352 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEM 765
            A++VG +DL+E+I+GGFM+FD++IA+PDMM  V  LGK+LGPRGLMPNP+ GTVT N+ QA+++ K G +E+R +K GIVH   GKA F+E+ L  N  A V ++   KP GAKG Y K   + S+MGP  ++++  +
Sbjct:   90 AEVVGAEDLVERIQGGFMDFDRVIATPDMMALVGRLGKVLGPRGLMPNPRVGTVTPNVGQAVKDAKGGSIEFRVEKAGIVHAGIGKASFTEEQLTANVKAMVDALNKAKPSGAKGTYVKKVSLSSTMGPGFKIDVASL 227          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_CAUCR (50S ribosomal protein L1 OS=Caulobacter crescentus GN=rplA PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 9.484e-38
Identity = 73/138 (52.90%), Postives = 101/138 (73.19%), Query Frame = -1
Query:  352 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEM 765
            A+ VG DDL E+I GGFM+FD++IA+PDMM  V  LGK+LGPRGLMPNPK GTVT N+ QA+++ K G VE+R +K GIVH   GKA F+++ L IN  A ++++  +KP GAKGV+ K   + S+MGP  +++I  +
Sbjct:   90 AEHVGADDLYEKIAGGFMDFDRVIATPDMMALVGRLGKVLGPRGLMPNPKVGTVTPNVAQAVKDAKGGAVEFRVEKAGIVHAGIGKASFTDEALAINVKALIEALNRSKPSGAKGVFIKRVGLSSTMGPGFKVDISSI 227          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_CAUCN (50S ribosomal protein L1 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rplA PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 9.484e-38
Identity = 73/138 (52.90%), Postives = 101/138 (73.19%), Query Frame = -1
Query:  352 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEM 765
            A+ VG DDL E+I GGFM+FD++IA+PDMM  V  LGK+LGPRGLMPNPK GTVT N+ QA+++ K G VE+R +K GIVH   GKA F+++ L IN  A ++++  +KP GAKGV+ K   + S+MGP  +++I  +
Sbjct:   90 AEHVGADDLYEKIAGGFMDFDRVIATPDMMALVGRLGKVLGPRGLMPNPKVGTVTPNVAQAVKDAKGGAVEFRVEKAGIVHAGIGKASFTDEALAINVKALIEALNRSKPSGAKGVFIKRVGLSSTMGPGFKVDISSI 227          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_THEP1 (50S ribosomal protein L1 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rplA PE=3 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 1.239e-37
Identity = 75/140 (53.57%), Postives = 102/140 (72.86%), Query Frame = -1
Query:  349 ADLVGGDDLIEQI-KGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEML 765
            AD VG +DL+E+I K GF++FD  IA+PDMM  +  LGKILGPRGLMP+PK+GTVT  + +A++EFKKG++E R DKTG +HIP GK  F  + L  N ++AV+ I   KP G KG + K A + S+MGP I+LN++ +L
Sbjct:   92 ADYVGAEDLVEKIEKEGFLDFDVAIATPDMMRVIGRLGKILGPRGLMPSPKSGTVTQEVAEAVKEFKKGRIEVRTDKTGNIHIPVGKRSFDNEKLKENIISAVRQIMQMKPAGVKGQFIKKAVLSSTMGPGIKLNLQSLL 231          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_THETH (50S ribosomal protein L1 OS=Thermus thermophilus GN=rplA PE=1 SV=3)

HSP 1 Score: 154.451 bits (389), Expect = 6.147e-37
Identity = 71/135 (52.59%), Postives = 103/135 (76.30%), Query Frame = -1
Query:  364 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVAS-LGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLN 765
            AD VGG+++I++I  G+M+FD ++A+PD+M  V S LG+ILGPRGL+PNPKAGTV  NI + I E K G++E+R DKTG +H P GKA F  + L  N  A ++++EA+KP+GAKG + +S Y+ ++MGPS+R+N
Sbjct:   92 ADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRIN 226          
The following BLAST results are available for this feature:
BLAST of CN188884 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RL1_THESQ4.257e-3854.2950S ribosomal protein L1 OS=Thermotoga sp. (strain... [more]
RL1_DICTD7.262e-3853.8550S ribosomal protein L1 OS=Dictyoglomus turgidum ... [more]
RL1_DICT67.262e-3853.8550S ribosomal protein L1 OS=Dictyoglomus thermophi... [more]
RL1_THENN9.484e-3852.4850S ribosomal protein L1 OS=Thermotoga neapolitana... [more]
RL1_THEMA9.484e-3853.5750S ribosomal protein L1 OS=Thermotoga maritima GN... [more]
RL1_PHEZH9.484e-3850.7250S ribosomal protein L1 OS=Phenylobacterium zucin... [more]
RL1_CAUCR9.484e-3852.9050S ribosomal protein L1 OS=Caulobacter crescentus... [more]
RL1_CAUCN9.484e-3852.9050S ribosomal protein L1 OS=Caulobacter crescentus... [more]
RL1_THEP11.239e-3753.5750S ribosomal protein L1 OS=Thermotoga petrophila ... [more]
RL1_THETH6.147e-3752.5950S ribosomal protein L1 OS=Thermus thermophilus G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0006P10_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0006P10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188884 ID=CN188884|Name=CN188884|organism=Citrus sinensis|type=EST|length=765bp
TTTTTTTTTTTTTTTTTACAAGAATGGAAAAATATTCAGTAGCCATTCAA
GTAATTTTACAGAAAAAAAAATTGCGGTAATGAACCTGAGAGTGGGCGAT
AATAATAATATCTTTTTCAGTACGGAAAAAAGCCATGCTGTATGCATTTT
TCCTTTTTTTTATTTGCTACAATCTCATCCACATTGATAATCAAGATCTC
CTCACCTCACCATAATTCACTCTCCTACAACTTTTGCCAAGCAGTGGCAA
GCCCTGGCATGGGTATCAAAGAGGCTGACTGAACAGTTAAAGCTATCATT
TACAAAATTTAGTTATGTCATTTAGAAATTTGATGGAAGCTTGTAATCGA
GCATTTCTTTTATGTTTAATCGAATGGAAGGTCCCATTGATGAGCAAATG
TAAGCACTTTTCCAGTACACTCCTTTGGCCCCTTTTGGCTTGTTTGCTTC
AATTGATTTAACAGCAGCAAGGAAGTTTATGAGGAGGTCATCTTCAGAAA
AATCAGCTTTCCCAAAAGGTATGTGGACAATCCCAGTTTTATCTGCTCTA
TATTCAACTTTTCCCTTCTTGAATTCTTCTATGGCCTGAGGTATGTTAGT
TGTAACAGTACCAGCTTTAGGATTTGGCATGAGTCCCCGTGGTCCAAGAA
TTTTTCCTAGGCTGGCAACCTTAACCATCATATCTGGTGAAGCAATTAGC
TTGTCGAACTCCATGAATCCTCCTTTTATTTGTTCAATCAAGTCATCACC
ACCAACCAAATCTGC
back to top