CN188884

Overview
NameCN188884
Unique NameCN188884
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length765
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CN188884_ssr99 microsatellite CN188884_ssr99:99..110. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig2689 contig Csv1_Contig2689:1..766. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_THET8 (50S ribosomal protein L1 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rplA PE=1 SV=3)

HSP 1 Score: 154.451 bits (389), Expect = 6.147e-37
Identity = 71/135 (52.59%), Postives = 103/135 (76.30%), Query Frame = -1
Query:  364 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVAS-LGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLN 765
            AD VGG+++I++I  G+M+FD ++A+PD+M  V S LG+ILGPRGL+PNPKAGTV  NI + I E K G++E+R DKTG +H P GKA F  + L  N  A ++++EA+KP+GAKG + +S Y+ ++MGPS+R+N
Sbjct:   92 ADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRIN 226          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_THET2 (50S ribosomal protein L1 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rplA PE=1 SV=3)

HSP 1 Score: 154.451 bits (389), Expect = 6.147e-37
Identity = 71/135 (52.59%), Postives = 103/135 (76.30%), Query Frame = -1
Query:  364 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVAS-LGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLN 765
            AD VGG+++I++I  G+M+FD ++A+PD+M  V S LG+ILGPRGL+PNPKAGTV  NI + I E K G++E+R DKTG +H P GKA F  + L  N  A ++++EA+KP+GAKG + +S Y+ ++MGPS+R+N
Sbjct:   92 ADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRIN 226          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_MOOTA (50S ribosomal protein L1 OS=Moorella thermoacetica (strain ATCC 39073) GN=rplA PE=3 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 8.029e-37
Identity = 74/134 (55.22%), Postives = 97/134 (72.39%), Query Frame = -1
Query:  364 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLN 765
            AD VG +DL+E+I+GG+++FD  IA+PDMM  V  LG+ILGPRGLMPNPKAGTVT +I +A++E K GK+E+R DKT I+H P GKA F    L  NF A + ++   KP  AKG Y KS  + ++MGP IR+N
Sbjct:   92 ADFVGAEDLVEKIQGGWLDFDVAIATPDMMGLVGRLGRILGPRGLMPNPKAGTVTMDIARAVKEVKAGKIEFRVDKTAIIHAPIGKASFEASKLKENFQALMDALLRAKPATAKGQYLKSVSLATTMGPGIRVN 225          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_DESMR (50S ribosomal protein L1 OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=rplA PE=3 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 8.029e-37
Identity = 68/138 (49.28%), Postives = 98/138 (71.01%), Query Frame = -1
Query:  352 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEM 765
            AD VGGDDLIE++K GF++FD  +A+PDMM  V  +GKILGPRGLMPN K GTV+ +I +A+ E K GKVE++ DK G++H+P GK  F  + LL NF A + ++   KP  AKG Y ++  + ++MGP I+++ + +
Sbjct:   92 ADFVGGDDLIEKVKNGFLDFDSAVATPDMMASVGKIGKILGPRGLMPNAKTGTVSFDIGKAVSELKAGKVEFKVDKAGVLHVPLGKRSFGPEKLLDNFRAVIDAVMRLKPSAAKGTYLQAMALATTMGPGIKVDTQSV 229          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_HALOH (50S ribosomal protein L1 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=rplA PE=3 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.369e-36
Identity = 70/140 (50.00%), Postives = 98/140 (70.00%), Query Frame = -1
Query:  346 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLD 765
            AD+VG DDL E+IKGG+++FD  IA+PDMM  V  LG+ILGP+GLMPNPK GTVT  + +A+++ K GK+EYR DK G +H+P GK  F  DDL+ NF   +  +   +P  AKG Y +S  + S+MGP I+++  + +D
Sbjct:   92 ADVVGADDLAEKIKGGWLDFDVAIATPDMMSVVGKLGRILGPKGLMPNPKVGTVTFELEKAVKDAKAGKIEYRVDKNGNIHLPIGKVSFPVDDLMENFKTIIDVLLRERPASAKGRYMRSVTVSSTMGPGIKVDPNQAID 231          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_CAUSK (50S ribosomal protein L1 OS=Caulobacter sp. (strain K31) GN=rplA PE=3 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.369e-36
Identity = 73/135 (54.07%), Postives = 98/135 (72.59%), Query Frame = -1
Query:  361 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNI 765
            A+ VG +DL E+I GGFM+FD++IA+PDMM  V  LGK+LGPRGLMPNPK GTVT N+ QA+++ K G VE+R +K GIVH   GK  F+++ LLIN  A V ++   KP GAKG+Y K   + S+MGP  +++I
Sbjct:   90 AEHVGAEDLYEKIVGGFMDFDRVIATPDMMALVGRLGKVLGPRGLMPNPKVGTVTPNVGQAVKDAKGGAVEFRVEKAGIVHAGIGKVSFTDEALLINVKAMVDALVKAKPAGAKGIYVKRIGLSSTMGPGFKIDI 224          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_HELPS (50S ribosomal protein L1 OS=Helicobacter pylori (strain Shi470) GN=rplA PE=3 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 2.336e-36
Identity = 73/142 (51.41%), Postives = 99/142 (69.72%), Query Frame = -1
Query:  340 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLDYK 765
            AD+VGGDDL E+IK G ++FD +IA+PDMM  V  +G+ILGP+GLMPNPK GTVT +I +A+   K G+V +R DK G VH P GKA F E+ +  N L  VK+I   KP  AKG Y ++A +  +M PS+ L+ +E++D K
Sbjct:   93 ADVVGGDDLAEEIKNGRIDFDMVIATPDMMAVVGKVGRILGPKGLMPNPKTGTVTMDIAKAVSNAKSGQVNFRVDKKGNVHAPIGKASFPEEKIKENMLELVKTINRLKPSSAKGKYIRNATLSLTMSPSVNLDAQELMDIK 234          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_DEIGD (50S ribosomal protein L1 OS=Deinococcus geothermalis (strain DSM 11300) GN=rplA PE=3 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 2.336e-36
Identity = 70/136 (51.47%), Postives = 100/136 (73.53%), Query Frame = -1
Query:  361 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVAS-LGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNI 765
            AD+VGG+DLI++I  GFM+FD ++A+PDMM ++   L ++LGPRGL+PNPK+GTV  ++   +   K G++E+R DKTG+VH P GKA F   +L  N+ A + ++EA KP  AKGVY +SAY+ S+MGPSI L +
Sbjct:   92 ADVVGGEDLIDRIANGFMDFDAVVATPDMMAQIGQKLARLLGPRGLLPNPKSGTVGPDVAGMVRGLKAGRIEFRNDKTGVVHAPIGKASFDPSNLSANYRALLSALEAAKPAAAKGVYLRSAYLTSTMGPSIPLTL 227          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_HELPY (50S ribosomal protein L1 OS=Helicobacter pylori GN=rplA PE=1 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 3.051e-36
Identity = 73/142 (51.41%), Postives = 99/142 (69.72%), Query Frame = -1
Query:  340 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLDYK 765
            AD+VGGDDL E+IK G ++FD +IA+PDMM  V  +G+ILGP+GLMPNPK GTVT +I +A+   K G+V +R DK G VH P GKA F E+ +  N L  VK+I   KP  AKG Y ++A +  +M PS+ L+ +E++D K
Sbjct:   93 ADVVGGDDLAEEIKNGRIDFDMVIATPDMMAVVGKVGRILGPKGLMPNPKTGTVTMDIAKAVSNAKSGQVNFRVDKKGNVHAPIGKASFPEEKIKENMLELVKTINRLKPSSAKGKYIRNAALSLTMSPSVSLDAQELMDIK 234          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_HELPJ (50S ribosomal protein L1 OS=Helicobacter pylori J99 GN=rplA PE=3 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 3.051e-36
Identity = 73/142 (51.41%), Postives = 99/142 (69.72%), Query Frame = -1
Query:  340 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEMLDYK 765
            AD+VGGDDL E+IK G ++FD +IA+PDMM  V  +G+ILGP+GLMPNPK GTVT +I +A+   K G+V +R DK G VH P GKA F E+ +  N L  VK+I   KP  AKG Y ++A +  +M PS+ L+ +E++D K
Sbjct:   93 ADVVGGDDLAEEIKNGRIDFDMVIATPDMMAVVGKVGRILGPKGLMPNPKTGTVTMDIAKAVTNAKSGQVNFRVDKKGNVHAPIGKASFPEEKIKENMLELVKTINRLKPSSAKGKYIRNAALSLTMSPSVNLDAQELMDIK 234          
The following BLAST results are available for this feature:
BLAST of CN188884 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RL1_THET86.147e-3752.5950S ribosomal protein L1 OS=Thermus thermophilus (... [more]
RL1_THET26.147e-3752.5950S ribosomal protein L1 OS=Thermus thermophilus (... [more]
RL1_MOOTA8.029e-3755.2250S ribosomal protein L1 OS=Moorella thermoacetica... [more]
RL1_DESMR8.029e-3749.2850S ribosomal protein L1 OS=Desulfovibrio magnetic... [more]
RL1_HALOH1.369e-3650.0050S ribosomal protein L1 OS=Halothermothrix orenii... [more]
RL1_CAUSK1.369e-3654.0750S ribosomal protein L1 OS=Caulobacter sp. (strai... [more]
RL1_HELPS2.336e-3651.4150S ribosomal protein L1 OS=Helicobacter pylori (s... [more]
RL1_DEIGD2.336e-3651.4750S ribosomal protein L1 OS=Deinococcus geothermal... [more]
RL1_HELPY3.051e-3651.4150S ribosomal protein L1 OS=Helicobacter pylori GN... [more]
RL1_HELPJ3.051e-3651.4150S ribosomal protein L1 OS=Helicobacter pylori J9... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0006P10_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0006P10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188884 ID=CN188884|Name=CN188884|organism=Citrus sinensis|type=EST|length=765bp
TTTTTTTTTTTTTTTTTACAAGAATGGAAAAATATTCAGTAGCCATTCAA
GTAATTTTACAGAAAAAAAAATTGCGGTAATGAACCTGAGAGTGGGCGAT
AATAATAATATCTTTTTCAGTACGGAAAAAAGCCATGCTGTATGCATTTT
TCCTTTTTTTTATTTGCTACAATCTCATCCACATTGATAATCAAGATCTC
CTCACCTCACCATAATTCACTCTCCTACAACTTTTGCCAAGCAGTGGCAA
GCCCTGGCATGGGTATCAAAGAGGCTGACTGAACAGTTAAAGCTATCATT
TACAAAATTTAGTTATGTCATTTAGAAATTTGATGGAAGCTTGTAATCGA
GCATTTCTTTTATGTTTAATCGAATGGAAGGTCCCATTGATGAGCAAATG
TAAGCACTTTTCCAGTACACTCCTTTGGCCCCTTTTGGCTTGTTTGCTTC
AATTGATTTAACAGCAGCAAGGAAGTTTATGAGGAGGTCATCTTCAGAAA
AATCAGCTTTCCCAAAAGGTATGTGGACAATCCCAGTTTTATCTGCTCTA
TATTCAACTTTTCCCTTCTTGAATTCTTCTATGGCCTGAGGTATGTTAGT
TGTAACAGTACCAGCTTTAGGATTTGGCATGAGTCCCCGTGGTCCAAGAA
TTTTTCCTAGGCTGGCAACCTTAACCATCATATCTGGTGAAGCAATTAGC
TTGTCGAACTCCATGAATCCTCCTTTTATTTGTTCAATCAAGTCATCACC
ACCAACCAAATCTGC
back to top