CN188884

Overview
NameCN188884
Unique NameCN188884
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length765
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CN188884_ssr99 microsatellite CN188884_ssr99:99..110. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig2689 contig Csv1_Contig2689:1..766. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_GEOSF (50S ribosomal protein L1 OS=Geobacter sp. (strain FRC-32) GN=rplA PE=3 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.514e-35
Identity = 69/138 (50.00%), Postives = 94/138 (68.12%), Query Frame = -1
Query:  352 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEM 765
            AD VG DDL+ +I+ G+ EFD  IA+PDMM  V  +GK+LGPRGLMPNPK GTVT ++ +A+ E K GKVE+R +K GI+H P GK  F  D L  N LA + ++  +KP  AKG Y K   + S+MGP + L++ ++
Sbjct:   91 ADFVGADDLVAKIQEGWFEFDTAIATPDMMGVVGKIGKLLGPRGLMPNPKVGTVTFDVGRAVNESKSGKVEFRVEKAGIIHAPVGKVSFETDKLKENILALIDALVKSKPSAAKGTYIKKISVSSTMGPGVNLDVSDV 228          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_DEHSC (50S ribosomal protein L1 OS=Dehalococcoides sp. (strain CBDB1) GN=rplA PE=3 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.514e-35
Identity = 73/138 (52.90%), Postives = 102/138 (73.91%), Query Frame = -1
Query:  358 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTT--NIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIK 765
            AD+ GGD+LI++I+ GF++FD  I++PDMM KV  LGK+LG RGLMPNPK+GTV    +  + IEE +KG+VE++ D++GIVHI  GKA F    LL N  + V +I  +KP GAKG Y KSAY+ ++MGP +RL+++
Sbjct:   92 ADVYGGDELIKKIEAGFLDFDVAISTPDMMSKVGKLGKVLGRRGLMPNPKSGTVVPAEDFKKVIEEARKGRVEFKLDRSGIVHIILGKASFEGQMLLENMTSVVDAIIRSKPTGAKGQYIKSAYLATTMGPGVRLDLR 229          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_DEHSB (50S ribosomal protein L1 OS=Dehalococcoides sp. (strain BAV1) GN=rplA PE=3 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.514e-35
Identity = 73/138 (52.90%), Postives = 102/138 (73.91%), Query Frame = -1
Query:  358 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTT--NIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIK 765
            AD+ GGD+LI++I+ GF++FD  I++PDMM KV  LGK+LG RGLMPNPK+GTV    +  + IEE +KG+VE++ D++GIVHI  GKA F    LL N  + V +I  +KP GAKG Y KSAY+ ++MGP +RL+++
Sbjct:   92 ADVYGGDELIKKIEAGFLDFDVAISTPDMMSKVGKLGKVLGRRGLMPNPKSGTVVPAEDFKKVIEEARKGRVEFKLDRSGIVHIILGKASFEGQMLLENMTSVVDAIIRSKPTGAKGQYIKSAYLATTMGPGVRLDLR 229          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_PELPD (50S ribosomal protein L1 OS=Pelobacter propionicus (strain DSM 2379) GN=rplA PE=3 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.978e-35
Identity = 72/138 (52.17%), Postives = 95/138 (68.84%), Query Frame = -1
Query:  352 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEM 765
            AD VG +DL+ +I+ G+ EFD  IA+PDMM  V  +GK+LGPRGLMPNPK GTVT  + +A++E K GKVE+R +K GIVH P GK  F  D L  N LA V+++   KP  AKG+Y K   + S+MGP I L+I ++
Sbjct:   92 ADYVGAEDLVSKIQEGWFEFDTAIATPDMMGVVGKIGKLLGPRGLMPNPKVGTVTFEVSRAVKESKAGKVEFRVEKAGIVHAPVGKVSFDADSLKGNLLALVEALVKAKPSAAKGIYIKKISMSSTMGPGINLDIADV 229          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_PARL1 (50S ribosomal protein L1 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rplA PE=3 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.978e-35
Identity = 69/133 (51.88%), Postives = 95/133 (71.43%), Query Frame = -1
Query:  367 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRL 765
            AD+VG DDL E ++ G ++FD+ IA+PDMM  V  LGK+LGPRGLMPNPK GTVT ++ +A++  K G VE+R +K GI+H   GKA FSED +L+N  A + +++  KP GAKG Y K   I S+MGP +++
Sbjct:   92 ADIVGDDDLAEIVQSGKIDFDRCIATPDMMPLVGRLGKVLGPRGLMPNPKVGTVTPDVAEAVKAAKGGAVEFRVEKAGIIHAGVGKASFSEDQILVNIRALIDAVQKAKPTGAKGTYIKRIAISSTMGPGVKV 224          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_DEHE1 (50S ribosomal protein L1 OS=Dehalococcoides ethenogenes (strain 195) GN=rplA PE=3 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.978e-35
Identity = 71/138 (51.45%), Postives = 102/138 (73.91%), Query Frame = -1
Query:  358 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTT--NIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIK 765
            AD+ GGD+LI++++ GF++FD  I++PDMM KV  LGK+LG RGLMPNPK+GTV    +  Q IEE +KG+VE++ D++GIVHI  GKA F    LL N  + V +I  +KP GAKG Y KSAY+ ++MGP ++++++
Sbjct:   92 ADVYGGDELIKKVEAGFLDFDVAISTPDMMSKVGKLGKVLGRRGLMPNPKSGTVVPAEDFKQVIEEARKGRVEFKLDRSGIVHIILGKASFEGQALLENMTSVVDAIIRSKPTGAKGQYIKSAYLATTMGPGVKMDLR 229          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_HYPNA (50S ribosomal protein L1 OS=Hyphomonas neptunium (strain ATCC 15444) GN=rplA PE=3 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 2.583e-35
Identity = 68/137 (49.64%), Postives = 97/137 (70.80%), Query Frame = -1
Query:  355 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKE 765
            AD+VG DDL E++ GGFM+FD++IA+PDMM  V  LGK+LGPRGLMPNPK GTVT N+ QA+++ K G VE++ +K GIVH   GKA FS+ D+  N  A + ++   +P GAKG + +   + S+MG  + +++ E
Sbjct:   92 ADIVGADDLFEKVNGGFMDFDRVIATPDMMGLVGRLGKVLGPRGLMPNPKVGTVTPNVAQAVKDAKGGAVEFKVEKAGIVHAGVGKASFSDADIEKNVQAFISAVVKARPSGAKGTFVRKVTLSSTMGTGVAIDLAE 228          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_GEOUR (50S ribosomal protein L1 OS=Geobacter uraniireducens (strain Rf4) GN=rplA PE=3 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 2.583e-35
Identity = 69/138 (50.00%), Postives = 94/138 (68.12%), Query Frame = -1
Query:  352 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEM 765
            AD VG DDL+ +I+ G+ +FD  IA+PDMM  V  +GK+LGPRGLMPNPK GTVT ++ +A+ E K GKVE+R +K GI+H P GK  F  D L  N LA V ++  +KP  AKG Y K   + S+MGP + L++ ++
Sbjct:   91 ADFVGADDLVAKIQEGWFDFDTAIATPDMMGVVGKIGKLLGPRGLMPNPKVGTVTFDVGRAVNESKSGKVEFRVEKAGIIHAPVGKVSFDADKLKENILALVDALVKSKPSAAKGTYIKKISVSSTMGPGVNLDVSDV 228          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_DESAA (50S ribosomal protein L1 OS=Desulfatibacillum alkenivorans (strain AK-01) GN=rplA PE=3 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 2.583e-35
Identity = 65/134 (48.51%), Postives = 97/134 (72.39%), Query Frame = -1
Query:  364 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLN 765
            AD VG DDL+E+I+GG+++FDK IA+PDMM  V  +G+ILGPRGLMPN K GTVT ++ +A++E K GK+++R ++ GI+H P GK  F  + LL N  A  ++++  KP  AKG Y KS  + ++MGP ++++
Sbjct:   92 ADFVGNDDLVEKIQGGWLDFDKAIATPDMMGTVGKMGRILGPRGLMPNAKTGTVTFDVAKAVQELKAGKIDFRVERAGILHAPMGKVSFGAEKLLDNISAFFETVQRLKPSAAKGTYMKSIAVSTTMGPGVKID 225          
BLAST of CN188884 vs. ExPASy Swiss-Prot
Match: RL1_RHOCS (50S ribosomal protein L1 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rplA PE=3 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 3.373e-35
Identity = 75/139 (53.96%), Postives = 96/139 (69.06%), Query Frame = -1
Query:  349 ADLVGGDDLIEQIKGGFMEFDKLIASPDMMVKVASLGKILGPRGLMPNPKAGTVTTNIPQAIEEFKKGKVEYRADKTGIVHIPFGKADFSEDDLLINFLAAVKSIEANKPKGAKGVYWKSAYICSSMGPSIRLNIKEML 765
            AD+VG +DL ++I+ G   FD+ IA+PDMM  V  LGKILGPRGLMPNPK GTVT N+ +A++  K G VE+RA+KTGIVH   GKA FSE  L  N  A V +I   KP GAKG Y +   + S+MGP I+L+I  ++
Sbjct:   92 ADIVGAEDLADKIQAGEFNFDRCIATPDMMGVVGRLGKILGPRGLMPNPKLGTVTPNVAEAVKAAKGGAVEFRAEKTGIVHAGVGKASFSEQALEENIRAFVSAINRAKPSGAKGTYIEKVSLSSTMGPGIKLDIPALV 230          
The following BLAST results are available for this feature:
BLAST of CN188884 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RL1_GEOSF1.514e-3550.0050S ribosomal protein L1 OS=Geobacter sp. (strain ... [more]
RL1_DEHSC1.514e-3552.9050S ribosomal protein L1 OS=Dehalococcoides sp. (s... [more]
RL1_DEHSB1.514e-3552.9050S ribosomal protein L1 OS=Dehalococcoides sp. (s... [more]
RL1_PELPD1.978e-3552.1750S ribosomal protein L1 OS=Pelobacter propionicus... [more]
RL1_PARL11.978e-3551.8850S ribosomal protein L1 OS=Parvibaculum lavamenti... [more]
RL1_DEHE11.978e-3551.4550S ribosomal protein L1 OS=Dehalococcoides etheno... [more]
RL1_HYPNA2.583e-3549.6450S ribosomal protein L1 OS=Hyphomonas neptunium (... [more]
RL1_GEOUR2.583e-3550.0050S ribosomal protein L1 OS=Geobacter uraniireduce... [more]
RL1_DESAA2.583e-3548.5150S ribosomal protein L1 OS=Desulfatibacillum alke... [more]
RL1_RHOCS3.373e-3553.9650S ribosomal protein L1 OS=Rhodospirillum centenu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0006P10_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0006P10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188884 ID=CN188884|Name=CN188884|organism=Citrus sinensis|type=EST|length=765bp
TTTTTTTTTTTTTTTTTACAAGAATGGAAAAATATTCAGTAGCCATTCAA
GTAATTTTACAGAAAAAAAAATTGCGGTAATGAACCTGAGAGTGGGCGAT
AATAATAATATCTTTTTCAGTACGGAAAAAAGCCATGCTGTATGCATTTT
TCCTTTTTTTTATTTGCTACAATCTCATCCACATTGATAATCAAGATCTC
CTCACCTCACCATAATTCACTCTCCTACAACTTTTGCCAAGCAGTGGCAA
GCCCTGGCATGGGTATCAAAGAGGCTGACTGAACAGTTAAAGCTATCATT
TACAAAATTTAGTTATGTCATTTAGAAATTTGATGGAAGCTTGTAATCGA
GCATTTCTTTTATGTTTAATCGAATGGAAGGTCCCATTGATGAGCAAATG
TAAGCACTTTTCCAGTACACTCCTTTGGCCCCTTTTGGCTTGTTTGCTTC
AATTGATTTAACAGCAGCAAGGAAGTTTATGAGGAGGTCATCTTCAGAAA
AATCAGCTTTCCCAAAAGGTATGTGGACAATCCCAGTTTTATCTGCTCTA
TATTCAACTTTTCCCTTCTTGAATTCTTCTATGGCCTGAGGTATGTTAGT
TGTAACAGTACCAGCTTTAGGATTTGGCATGAGTCCCCGTGGTCCAAGAA
TTTTTCCTAGGCTGGCAACCTTAACCATCATATCTGGTGAAGCAATTAGC
TTGTCGAACTCCATGAATCCTCCTTTTATTTGTTCAATCAAGTCATCACC
ACCAACCAAATCTGC
back to top