CN181646
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CN181646 vs. ExPASy Swiss-Prot
Match: RRF_CLOAB (Ribosome-recycling factor OS=Clostridium acetobutylicum GN=frr PE=3 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 3.269e-13 Identity = 41/90 (45.56%), Postives = 57/90 (63.33%), Query Frame = 1 Query: 454 IGPTVKETAVSQMEAAIVALSRELTKLRTGRASPGMLDHIIVETGGVKMPLNHLAVVSVLDSKTLSINPYDPNTLKELESAIVSSPLGLN 723 I +KE +M +I AL +ELT ++ GRA+P MLD I V+ G PLN LA +SV +S+ L I P+D + +K +E AI+ S LGLN Sbjct: 2 ISDIIKELE-EKMTKSISALKKELTSMKAGRANPAMLDRIEVDYYGTMTPLNQLANISVPESRVLMIQPWDKSAMKSIEKAILISDLGLN 90
BLAST of CN181646 vs. ExPASy Swiss-Prot
Match: RRF_THISH (Ribosome-recycling factor OS=Thioalkalivibrio sp. (strain HL-EbGR7) GN=frr PE=3 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 4.269e-13 Identity = 35/87 (40.23%), Postives = 62/87 (71.26%), Query Frame = 1 Query: 463 TVKETAVSQMEAAIVALSRELTKLRTGRASPGMLDHIIVETGGVKMPLNHLAVVSVLDSKTLSINPYDPNTLKELESAIVSSPLGLN 723 ++K+ A ++M +I +L EL K+RTGRA +LDH++VE G +P++ +A V+V D++TL++ P++ + ++E AI++S LGLN Sbjct: 4 SIKKDAKARMGKSIESLRNELAKIRTGRAHTSLLDHVMVEYYGSDVPISQVANVNVEDARTLTVTPWEKTMVSKVEKAIMTSDLGLN 90
BLAST of CN181646 vs. ExPASy Swiss-Prot
Match: RRF_SHISS (Ribosome-recycling factor OS=Shigella sonnei (strain Ss046) GN=frr PE=3 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 4.269e-13 Identity = 38/86 (44.19%), Postives = 57/86 (66.28%), Query Frame = 1 Query: 466 VKETAVSQMEAAIVALSRELTKLRTGRASPGMLDHIIVETGGVKMPLNHLAVVSVLDSKTLSINPYDPNTLKELESAIVSSPLGLN 723 +++ A +M+ + A +++K+RTGRASP +LD I+VE G PL LA V+V DS+TL IN +D + +E AI++S LGLN Sbjct: 5 IRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLN 90
BLAST of CN181646 vs. ExPASy Swiss-Prot
Match: RRF_SHIFL (Ribosome-recycling factor OS=Shigella flexneri GN=frr PE=3 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 4.269e-13 Identity = 38/86 (44.19%), Postives = 57/86 (66.28%), Query Frame = 1 Query: 466 VKETAVSQMEAAIVALSRELTKLRTGRASPGMLDHIIVETGGVKMPLNHLAVVSVLDSKTLSINPYDPNTLKELESAIVSSPLGLN 723 +++ A +M+ + A +++K+RTGRASP +LD I+VE G PL LA V+V DS+TL IN +D + +E AI++S LGLN Sbjct: 5 IRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLN 90
BLAST of CN181646 vs. ExPASy Swiss-Prot
Match: RRF_SHIF8 (Ribosome-recycling factor OS=Shigella flexneri serotype 5b (strain 8401) GN=frr PE=3 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 4.269e-13 Identity = 38/86 (44.19%), Postives = 57/86 (66.28%), Query Frame = 1 Query: 466 VKETAVSQMEAAIVALSRELTKLRTGRASPGMLDHIIVETGGVKMPLNHLAVVSVLDSKTLSINPYDPNTLKELESAIVSSPLGLN 723 +++ A +M+ + A +++K+RTGRASP +LD I+VE G PL LA V+V DS+TL IN +D + +E AI++S LGLN Sbjct: 5 IRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLN 90
BLAST of CN181646 vs. ExPASy Swiss-Prot
Match: RRF_SHIDS (Ribosome-recycling factor OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=frr PE=3 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 4.269e-13 Identity = 38/86 (44.19%), Postives = 57/86 (66.28%), Query Frame = 1 Query: 466 VKETAVSQMEAAIVALSRELTKLRTGRASPGMLDHIIVETGGVKMPLNHLAVVSVLDSKTLSINPYDPNTLKELESAIVSSPLGLN 723 +++ A +M+ + A +++K+RTGRASP +LD I+VE G PL LA V+V DS+TL IN +D + +E AI++S LGLN Sbjct: 5 IRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLN 90
BLAST of CN181646 vs. ExPASy Swiss-Prot
Match: RRF_SHIBS (Ribosome-recycling factor OS=Shigella boydii serotype 4 (strain Sb227) GN=frr PE=3 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 4.269e-13 Identity = 38/86 (44.19%), Postives = 57/86 (66.28%), Query Frame = 1 Query: 466 VKETAVSQMEAAIVALSRELTKLRTGRASPGMLDHIIVETGGVKMPLNHLAVVSVLDSKTLSINPYDPNTLKELESAIVSSPLGLN 723 +++ A +M+ + A +++K+RTGRASP +LD I+VE G PL LA V+V DS+TL IN +D + +E AI++S LGLN Sbjct: 5 IRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLN 90
BLAST of CN181646 vs. ExPASy Swiss-Prot
Match: RRF_SHIB3 (Ribosome-recycling factor OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=frr PE=3 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 4.269e-13 Identity = 38/86 (44.19%), Postives = 57/86 (66.28%), Query Frame = 1 Query: 466 VKETAVSQMEAAIVALSRELTKLRTGRASPGMLDHIIVETGGVKMPLNHLAVVSVLDSKTLSINPYDPNTLKELESAIVSSPLGLN 723 +++ A +M+ + A +++K+RTGRASP +LD I+VE G PL LA V+V DS+TL IN +D + +E AI++S LGLN Sbjct: 5 IRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLN 90
BLAST of CN181646 vs. ExPASy Swiss-Prot
Match: RRF_SALTY (Ribosome-recycling factor OS=Salmonella typhimurium GN=frr PE=3 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 4.269e-13 Identity = 39/86 (45.35%), Postives = 57/86 (66.28%), Query Frame = 1 Query: 466 VKETAVSQMEAAIVALSRELTKLRTGRASPGMLDHIIVETGGVKMPLNHLAVVSVLDSKTLSINPYDPNTLKELESAIVSSPLGLN 723 +++ A +ME + A +++K+RTGRASP +LD I+VE G PL LA V+V DS+TL IN +D + +E AI++S LGLN Sbjct: 5 IRKDAEVRMEKCVEAFKTQISKVRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMGPAVEKAIMASDLGLN 90
BLAST of CN181646 vs. ExPASy Swiss-Prot
Match: RRF_SALTI (Ribosome-recycling factor OS=Salmonella typhi GN=frr PE=3 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 4.269e-13 Identity = 39/86 (45.35%), Postives = 57/86 (66.28%), Query Frame = 1 Query: 466 VKETAVSQMEAAIVALSRELTKLRTGRASPGMLDHIIVETGGVKMPLNHLAVVSVLDSKTLSINPYDPNTLKELESAIVSSPLGLN 723 +++ A +ME + A +++K+RTGRASP +LD I+VE G PL LA V+V DS+TL IN +D + +E AI++S LGLN Sbjct: 5 IRKDAEVRMEKCVEAFKTQISKVRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMGPAVEKAIMASDLGLN 90 The following BLAST results are available for this feature:
BLAST of CN181646 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 303
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CN181646 ID=CN181646; Name=CN181646; organism=Citrus sinensis; type=EST; length=723bpback to top |