CN181646
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CN181646 vs. ExPASy Swiss-Prot
Match: RRF_ECO7I (Ribosome-recycling factor OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=frr PE=3 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 4.269e-13 Identity = 38/86 (44.19%), Postives = 57/86 (66.28%), Query Frame = 1 Query: 466 VKETAVSQMEAAIVALSRELTKLRTGRASPGMLDHIIVETGGVKMPLNHLAVVSVLDSKTLSINPYDPNTLKELESAIVSSPLGLN 723 +++ A +M+ + A +++K+RTGRASP +LD I+VE G PL LA V+V DS+TL IN +D + +E AI++S LGLN Sbjct: 5 IRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLN 90
BLAST of CN181646 vs. ExPASy Swiss-Prot
Match: RRF_ECO5E (Ribosome-recycling factor OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=frr PE=3 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 4.269e-13 Identity = 38/86 (44.19%), Postives = 57/86 (66.28%), Query Frame = 1 Query: 466 VKETAVSQMEAAIVALSRELTKLRTGRASPGMLDHIIVETGGVKMPLNHLAVVSVLDSKTLSINPYDPNTLKELESAIVSSPLGLN 723 +++ A +M+ + A +++K+RTGRASP +LD I+VE G PL LA V+V DS+TL IN +D + +E AI++S LGLN Sbjct: 5 IRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLN 90
BLAST of CN181646 vs. ExPASy Swiss-Prot
Match: RRF_ECO57 (Ribosome-recycling factor OS=Escherichia coli O157:H7 GN=frr PE=1 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 4.269e-13 Identity = 38/86 (44.19%), Postives = 57/86 (66.28%), Query Frame = 1 Query: 466 VKETAVSQMEAAIVALSRELTKLRTGRASPGMLDHIIVETGGVKMPLNHLAVVSVLDSKTLSINPYDPNTLKELESAIVSSPLGLN 723 +++ A +M+ + A +++K+RTGRASP +LD I+VE G PL LA V+V DS+TL IN +D + +E AI++S LGLN Sbjct: 5 IRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLN 90
BLAST of CN181646 vs. ExPASy Swiss-Prot
Match: RRF_ECO55 (Ribosome-recycling factor OS=Escherichia coli (strain 55989 / EAEC) GN=frr PE=3 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 4.269e-13 Identity = 38/86 (44.19%), Postives = 57/86 (66.28%), Query Frame = 1 Query: 466 VKETAVSQMEAAIVALSRELTKLRTGRASPGMLDHIIVETGGVKMPLNHLAVVSVLDSKTLSINPYDPNTLKELESAIVSSPLGLN 723 +++ A +M+ + A +++K+RTGRASP +LD I+VE G PL LA V+V DS+TL IN +D + +E AI++S LGLN Sbjct: 5 IRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLN 90
BLAST of CN181646 vs. ExPASy Swiss-Prot
Match: RRF_ECO45 (Ribosome-recycling factor OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=frr PE=3 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 4.269e-13 Identity = 38/86 (44.19%), Postives = 57/86 (66.28%), Query Frame = 1 Query: 466 VKETAVSQMEAAIVALSRELTKLRTGRASPGMLDHIIVETGGVKMPLNHLAVVSVLDSKTLSINPYDPNTLKELESAIVSSPLGLN 723 +++ A +M+ + A +++K+RTGRASP +LD I+VE G PL LA V+V DS+TL IN +D + +E AI++S LGLN Sbjct: 5 IRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLN 90
BLAST of CN181646 vs. ExPASy Swiss-Prot
Match: RRF_ECO27 (Ribosome-recycling factor OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=frr PE=3 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 4.269e-13 Identity = 38/86 (44.19%), Postives = 57/86 (66.28%), Query Frame = 1 Query: 466 VKETAVSQMEAAIVALSRELTKLRTGRASPGMLDHIIVETGGVKMPLNHLAVVSVLDSKTLSINPYDPNTLKELESAIVSSPLGLN 723 +++ A +M+ + A +++K+RTGRASP +LD I+VE G PL LA V+V DS+TL IN +D + +E AI++S LGLN Sbjct: 5 IRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLN 90
BLAST of CN181646 vs. ExPASy Swiss-Prot
Match: RRF_ECO24 (Ribosome-recycling factor OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=frr PE=3 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 4.269e-13 Identity = 38/86 (44.19%), Postives = 57/86 (66.28%), Query Frame = 1 Query: 466 VKETAVSQMEAAIVALSRELTKLRTGRASPGMLDHIIVETGGVKMPLNHLAVVSVLDSKTLSINPYDPNTLKELESAIVSSPLGLN 723 +++ A +M+ + A +++K+RTGRASP +LD I+VE G PL LA V+V DS+TL IN +D + +E AI++S LGLN Sbjct: 5 IRKDAEVRMDKCVEAFKTQISKIRTGRASPSLLDGIVVEYYGTPTPLRQLASVTVEDSRTLKINVFDRSMSPAVEKAIMASDLGLN 90
BLAST of CN181646 vs. ExPASy Swiss-Prot
Match: RRF_DIAST (Ribosome-recycling factor OS=Diaphorobacter sp. (strain TPSY) GN=frr PE=3 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 4.269e-13 Identity = 37/86 (43.02%), Postives = 59/86 (68.60%), Query Frame = 1 Query: 466 VKETAVSQMEAAIVALSRELTKLRTGRASPGMLDHIIVETGGVKMPLNHLAVVSVLDSKTLSINPYDPNTLKELESAIVSSPLGLN 723 +K+T ++M+ +I A L K+RTGRA+P +LD I VE G +PL+ +A V++LD++T+S+ P++ N ++E AI S LGLN Sbjct: 6 IKKTTEAKMDQSIAAFKNNLAKIRTGRANPQLLDTIHVEYYGSMVPLSQVANVALLDARTISVQPWEKNMGAKIEKAIRESDLGLN 91
BLAST of CN181646 vs. ExPASy Swiss-Prot
Match: RRF_CLOTE (Ribosome-recycling factor OS=Clostridium tetani GN=frr PE=3 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 4.269e-13 Identity = 38/86 (44.19%), Postives = 56/86 (65.12%), Query Frame = 1 Query: 466 VKETAVSQMEAAIVALSRELTKLRTGRASPGMLDHIIVETGGVKMPLNHLAVVSVLDSKTLSINPYDPNTLKELESAIVSSPLGLN 723 + TA +M A++AL ++L L+ GRA+P MLD I E G PL+ LA +SV +++ L I P+D ++LK +E AI+ S LGLN Sbjct: 5 IMNTAEDKMSKALLALKKDLASLKAGRANPAMLDKIEAEYYGTMTPLSQLANISVPEARILQIQPWDKSSLKAIEKAILVSDLGLN 90
BLAST of CN181646 vs. ExPASy Swiss-Prot
Match: RRF_CHRSD (Ribosome-recycling factor OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=frr PE=3 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 4.269e-13 Identity = 36/86 (41.86%), Postives = 62/86 (72.09%), Query Frame = 1 Query: 466 VKETAVSQMEAAIVALSRELTKLRTGRASPGMLDHIIVETGGVKMPLNHLAVVSVLDSKTLSINPYDPNTLKELESAIVSSPLGLN 723 +K+ A ++M+ ++ AL+ K+RTGRA P +LD + VE G +MPLN +A V+V D++TL++ P++ + + ++E AI++S LGLN Sbjct: 5 IKKDADARMKKSVEALNANFHKIRTGRAHPSLLDAVTVEYYGSEMPLNQVASVNVEDARTLAVVPWEKSMVPKVEKAIMTSDLGLN 90 The following BLAST results are available for this feature:
BLAST of CN181646 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 303
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CN181646 ID=CN181646; Name=CN181646; organism=Citrus sinensis; type=EST; length=723bpback to top |