CN188561

Overview
NameCN188561
Unique NameCN188561
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length707
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CN188561 vs. ExPASy Swiss-Prot
Match: SPAST_DANRE (Spastin OS=Danio rerio GN=spast PE=2 SV=2)

HSP 1 Score: 102.834 bits (255), Expect = 1.844e-21
Identity = 55/143 (38.46%), Postives = 85/143 (59.44%), Query Frame = 3
Query:   78 RAVLFEGPPGTGKTSCARVIANQAGVPLMYVPLEVVMSKYYGESERLLGKVFSLANELPNGAIIFLDEVDSFAVARDSEMHEATRRILSVLLRQIDGFEQ--DKKVVVIAATNRKQDLDPALISRFDSMITFGLPDHENRQEI 500
            R +L  GPPG GKT  A+ +A ++      +    + SKY GE E+L+  +F++A EL   +IIF+DE+DS    R    H+A+RR+ +  L + DG +   D++V+V+ ATNR Q+LD A++ RF   I   LP  E R ++
Sbjct:  329 RGLLLFGPPGNGKTMLAKAVAMESNATFFNISAATLTSKYVGEGEKLVRALFAVAREL-QPSIIFIDEIDSLLCERREGEHDASRRLKTEFLIEFDGVQSGGDERVLVMGATNRPQELDEAVLRRFAKRIYVALPTEETRLKL 470          
BLAST of CN188561 vs. ExPASy Swiss-Prot
Match: PSMR_UNCMA (Proteasome-activating nucleotidase OS=Uncultured methanogenic archaeon RC-I GN=pan PE=3 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.844e-21
Identity = 63/172 (36.63%), Postives = 95/172 (55.23%), Query Frame = 3
Query:   18 PEVYDDIALETRCKFESNRPRAVLFEGPPGTGKTSCARVIANQAGVPLMYVPLEVVMSKYYGESERLLGKVFSLANELPNGAIIFLDEVDSFAVARDSEMHEATR---RILSVLLRQIDGFEQDKKVVVIAATNRKQDLDPALI--SRFDSMITFGLPDHENRQEIAAQYAK 518
            PE++  + +E         P+ VL  GPPGTGKT  A+ +AN+     + +    ++ KY GE  R++ ++F LA E  + +IIF+DE+DS    R   +    R   R L  LL ++DGF+    V ++AATNR   LDPAL+   RFD MI   +P  E R++I   +A+
Sbjct:  182 PELFQKVGIEP--------PKGVLLYGPPGTGKTLLAKAVANRTKATFIRIIGSELVQKYIGEGARMVRELFELAKE-KSPSIIFIDEIDSIGAKRLDSITSGDREVQRTLVQLLAEMDGFDPRGNVRILAATNRPDILDPALLRPGRFDRMIKVPMPTAEAREQILKIHAR 344          
BLAST of CN188561 vs. ExPASy Swiss-Prot
Match: PRS4_CHICK (26S protease regulatory subunit 4 OS=Gallus gallus GN=PSMC1 PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.844e-21
Identity = 66/204 (32.35%), Postives = 103/204 (50.49%), Query Frame = 3
Query:   18 PEVYDDIALETRCKFESNRPRAVLFEGPPGTGKTSCARVIANQAGVPLMYVPLEVVMSKYYGESERLLGKVFSLANELPNGAIIFLDEVDSFAVAR---DSEMHEATRRILSVLLRQIDGFEQDKKVVVIAATNRKQDLDPALI--SRFDSMITFGLPDHENRQEIAAQYAKH---XXXXXXXXXXXXXXXMSGRDIRDVCQQA 605
            PE Y+++ ++         P+ V+  GPPGTGKT  A+ +ANQ     + V    ++ KY G+  +L+ ++F +A E    +I+F+DE+D+    R   +S      +R +  LL Q+DGF+    V VI ATNR + LDPALI   R D  I F LPD + ++ I   +                     +SG DI+ +C +A
Sbjct:  208 PEYYEEMGIKP--------PKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEE-HGPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDELIMAKDDLSGADIKAICTEA 402          
BLAST of CN188561 vs. ExPASy Swiss-Prot
Match: MSP1_CAEEL (Mitochondrial sorting homolog OS=Caenorhabditis elegans GN=mspn-1 PE=1 SV=2)

HSP 1 Score: 102.834 bits (255), Expect = 1.844e-21
Identity = 74/240 (30.83%), Postives = 118/240 (49.17%), Query Frame = 3
Query:   21 EVYDDIALETRCKFESNR-----PRAVLFEGPPGTGKTSCARVIANQAGVPLMYVPLEVVMSKYYGESERLLGKVFSLANELPNGAIIFLDEVDSFAVARDSEMHEATRRILSVLLRQIDGFEQD-KKVVVIAATNRKQDLDPALISRFDSMITFGLPDHENRQEI---AAQYAKHXXXXXXXXXXXXXXXMSGRDIRDVCQQA--ERSWASKIIRGQITKDGEQACLPPLQEYIESATN 707
            E+ D I L  R   +S       PR +L  GPPG GKT  A+ +A  AG   + + +  +  K+YGES++L   VFS+A +     IIF+DE+DSF   R S  HE+T  + +  +   DGF     +++V+ ATNR +D+D A++ R  +     +P+ + R +I     +  K                +SG D+++VC+ A   R+ A+    G + +      LP  Q   ESA +
Sbjct:   94 ELKDRIILPLRFASQSGSHLLSPPRGILLYGPPGCGKTLLAKAVARAAGCRFINLQVSNLTDKWYGESQKLAAAVFSVAQKF-QPTIIFIDEIDSFLRDRQSHDHESTAMMKAQFMTLWDGFSSSGDQIIVMGATNRPRDVDAAILRRMTARFQVPVPNAKQRSQILNVILRNEKINNTVNLGEIAQAAEGLSGSDLKEVCRLALLARAKATVASGGSVNQ-----LLPLEQSDFESAVH 327          
BLAST of CN188561 vs. ExPASy Swiss-Prot
Match: KTNA1_STRPU (Katanin p60 ATPase-containing subunit OS=Strongylocentrotus purpuratus GN=KATNA1 PE=1 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.844e-21
Identity = 70/198 (35.35%), Postives = 100/198 (50.51%), Query Frame = 3
Query:   78 RAVLFEGPPGTGKTSCARVIANQAGVPLMYVPLEVVMSKYYGESERLLGKVFSLANELPNGAIIFLDEVDSFAVARDS-EMHEATRRILSVLLRQIDGF-------EQDKKVVVIAATNRKQDLDPALISRFDSMITFGLPDHENRQEIAAQYAKHXXXXXXXXXXXXXXXM---SGRDIRDVCQQAERSWASKIIRG 638
            + VL  GPPGTGKT  A+ +A + G     V    + SKY+GESE+L+  +F +A      + IF+DE+DS    R +   HEA+RR+ S LL Q+DG        E  K V+V+AATN   D+D AL  R +  I   LP+ + R+++     K                M   SG DI +VC+ A      + I+G
Sbjct:  268 KGVLMVGPPGTGKTMLAKAVATECGTTFFNVSSASLTSKYHGESEKLVRLLFEMA-RFYAPSTIFIDEIDSICSKRGTGSEHEASRRVKSELLIQMDGVSGPSAGEESSKMVMVLAATNFPWDIDEALRRRLEKRIYIPLPEIDGREQLLRINLKEVPLADDIDLKSIAEKMDGYSGADITNVCRDASMMAMRRRIQG 464          
BLAST of CN188561 vs. ExPASy Swiss-Prot
Match: SPAST_DROYA (Spastin OS=Drosophila yakuba GN=spas PE=3 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.409e-21
Identity = 54/142 (38.03%), Postives = 82/142 (57.75%), Query Frame = 3
Query:   78 RAVLFEGPPGTGKTSCARVIANQAGVPLMYVPLEVVMSKYYGESERLLGKVFSLANELPNGAIIFLDEVDSFAVARDSEMHEATRRILSVLLRQIDGF---EQDKKVVVIAATNRKQDLDPALISRFDSMITFGLPDHENRQ 494
            + +L  GPPG GKT  AR +A +     + +    + SKY G+ E+L+  +F++A  +   +IIF+DEVDS    R S  HEA+RR+ +  L + DG        ++VV+AATNR Q+LD A + RF   +   LPD + R+
Sbjct:  517 KGLLLFGPPGNGKTLLARAVATECSATFLNISAASLTSKYVGDGEKLVRALFAVARHM-QPSIIFIDEVDSLLSERSSSEHEASRRLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALRRFTKRVYVSLPDEQTRE 657          
BLAST of CN188561 vs. ExPASy Swiss-Prot
Match: SPAST_DROWI (Spastin OS=Drosophila willistoni GN=spas PE=3 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.409e-21
Identity = 54/142 (38.03%), Postives = 82/142 (57.75%), Query Frame = 3
Query:   78 RAVLFEGPPGTGKTSCARVIANQAGVPLMYVPLEVVMSKYYGESERLLGKVFSLANELPNGAIIFLDEVDSFAVARDSEMHEATRRILSVLLRQIDGF---EQDKKVVVIAATNRKQDLDPALISRFDSMITFGLPDHENRQ 494
            + +L  GPPG GKT  AR +A +     + +    + SKY G+ E+L+  +F++A  +   +IIF+DEVDS    R S  HEA+RR+ +  L + DG        ++VV+AATNR Q+LD A + RF   +   LPD + R+
Sbjct:  536 KGLLLFGPPGNGKTLLARAVATECSATFLNISAASLTSKYVGDGEKLVRALFAVARHM-QPSIIFIDEVDSLLSERSSNEHEASRRLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALRRFTKRVYVSLPDEQTRE 676          
BLAST of CN188561 vs. ExPASy Swiss-Prot
Match: SPAST_DROSI (Spastin OS=Drosophila simulans GN=spas PE=3 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.409e-21
Identity = 54/142 (38.03%), Postives = 82/142 (57.75%), Query Frame = 3
Query:   78 RAVLFEGPPGTGKTSCARVIANQAGVPLMYVPLEVVMSKYYGESERLLGKVFSLANELPNGAIIFLDEVDSFAVARDSEMHEATRRILSVLLRQIDGF---EQDKKVVVIAATNRKQDLDPALISRFDSMITFGLPDHENRQ 494
            + +L  GPPG GKT  AR +A +     + +    + SKY G+ E+L+  +F++A  +   +IIF+DEVDS    R S  HEA+RR+ +  L + DG        ++VV+AATNR Q+LD A + RF   +   LPD + R+
Sbjct:  517 KGLLLFGPPGNGKTLLARAVATECSATFLNISAASLTSKYVGDGEKLVRALFAVARHM-QPSIIFIDEVDSLLSERSSSEHEASRRLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALRRFTKRVYVSLPDEQTRE 657          
BLAST of CN188561 vs. ExPASy Swiss-Prot
Match: SPAST_DROSE (Spastin OS=Drosophila sechellia GN=spas PE=3 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.409e-21
Identity = 54/142 (38.03%), Postives = 82/142 (57.75%), Query Frame = 3
Query:   78 RAVLFEGPPGTGKTSCARVIANQAGVPLMYVPLEVVMSKYYGESERLLGKVFSLANELPNGAIIFLDEVDSFAVARDSEMHEATRRILSVLLRQIDGF---EQDKKVVVIAATNRKQDLDPALISRFDSMITFGLPDHENRQ 494
            + +L  GPPG GKT  AR +A +     + +    + SKY G+ E+L+  +F++A  +   +IIF+DEVDS    R S  HEA+RR+ +  L + DG        ++VV+AATNR Q+LD A + RF   +   LPD + R+
Sbjct:  517 KGLLLFGPPGNGKTLLARAVATECSATFLNISAASLTSKYVGDGEKLVRALFAVARHM-QPSIIFIDEVDSLLSERSSSEHEASRRLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALRRFTKRVYVSLPDEQTRE 657          
BLAST of CN188561 vs. ExPASy Swiss-Prot
Match: SPAST_DROPS (Spastin OS=Drosophila pseudoobscura pseudoobscura GN=spas PE=3 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.409e-21
Identity = 55/142 (38.73%), Postives = 82/142 (57.75%), Query Frame = 3
Query:   78 RAVLFEGPPGTGKTSCARVIANQAGVPLMYVPLEVVMSKYYGESERLLGKVFSLANELPNGAIIFLDEVDSFAVARDSEMHEATRRILSVLLRQIDGF---EQDKKVVVIAATNRKQDLDPALISRFDSMITFGLPDHENRQ 494
            + +L  GPPG GKT  AR +A +     + +    + SKY G+ E+L+  +F++A  L   +IIF+DEVDS    R S  HEA+RR+ +  L + DG        ++VV+AATNR Q+LD A + RF   +   LPD + R+
Sbjct:  547 KGLLLFGPPGNGKTLLARAVATECSATFLNISAASLTSKYVGDGEKLVRALFAVARHL-QPSIIFIDEVDSLLSERSSGEHEASRRLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALRRFTKRVYVSLPDEQTRE 687          
The following BLAST results are available for this feature:
BLAST of CN188561 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 381
Match NameE-valueIdentityDescription
SPAST_DANRE1.844e-2138.46Spastin OS=Danio rerio GN=spast PE=2 SV=2[more]
PSMR_UNCMA1.844e-2136.63Proteasome-activating nucleotidase OS=Uncultured m... [more]
PRS4_CHICK1.844e-2132.3526S protease regulatory subunit 4 OS=Gallus gallus... [more]
MSP1_CAEEL1.844e-2130.83Mitochondrial sorting homolog OS=Caenorhabditis el... [more]
KTNA1_STRPU1.844e-2135.35Katanin p60 ATPase-containing subunit OS=Strongylo... [more]
SPAST_DROYA2.409e-2138.03Spastin OS=Drosophila yakuba GN=spas PE=3 SV=1[more]
SPAST_DROWI2.409e-2138.03Spastin OS=Drosophila willistoni GN=spas PE=3 SV=1[more]
SPAST_DROSI2.409e-2138.03Spastin OS=Drosophila simulans GN=spas PE=3 SV=1[more]
SPAST_DROSE2.409e-2138.03Spastin OS=Drosophila sechellia GN=spas PE=3 SV=1[more]
SPAST_DROPS2.409e-2138.73Spastin OS=Drosophila pseudoobscura pseudoobscura ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0006E21_r Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0006E21, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN188561 ID=CN188561; Name=CN188561; organism=Citrus sinensis; type=EST; length=707bp
ACATTTTAGCTTCAAGCCCTGAAGTATATGATGATATTGCCCTTGAAACT
CGGTGTAAGTTTGAGTCGAATAGACCTAGGGCTGTGCTCTTTGAAGGTCC
ACCAGGTACAGGGAAGACATCATGTGCTCGTGTTATTGCTAATCAAGCGG
GTGTTCCATTGATGTATGTGCCACTGGAGGTTGTCATGTCAAAATACTAC
GGTGAAAGTGAGCGGCTATTGGGGAAAGTGTTTTCTCTTGCCAATGAGCT
TCCAAACGGAGCTATTATTTTCCTGGACGAGGTTGATTCTTTTGCTGTTG
CTCGTGATAGTGAAATGCATGAAGCTACCCGAAGAATTTTGTCCGTGTTG
TTGAGACAGATTGATGGATTCGAACAGGATAAAAAGGTGGTGGTGATTGC
TGCAACAAATAGAAAGCAAGACCTTGATCCTGCTTTAATAAGTCGGTTTG
ATTCAATGATTACCTTTGGCCTACCGGATCATGAGAATCGTCAGGAAATA
GCAGCTCAGTATGCAAAGCACCTAACAAAAGCTGAACTGGCCGAATTAGC
CACTGCTACAGAGGAAATGTCGGGAAGAGATATTAGGGATGTGTGTCAAC
AAGCAGAGCGATCATGGGCATCAAAGATAATTCGAGGGCAAATCACTAAG
GATGGAGAACAGGCTTGTCTTCCACCTCTACAAGAATACATTGAGAGTGC
TACAAAC
back to top