CK940096
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CK940096 vs. ExPASy Swiss-Prot
Match: RS29_NEUCR (40S ribosomal protein S29 OS=Neurospora crassa GN=rps-29 PE=3 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 3.862e-11 Identity = 24/39 (61.54%), Postives = 29/39 (74.36%), Query Frame = 1 Query: 130 SRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFVKYR 246 SR+CRVC + +IRKYGL CRQCFR A +IGF K+R Sbjct: 18 SRSCRVCTHSAGLIRKYGLNICRQCFREKANDIGFTKHR 56 HSP 2 Score: 30.0314 bits (66), Expect = 3.862e-11 Identity = 10/15 (66.67%), Postives = 12/15 (80.00%), Query Frame = 2 Query: 80 MGHSNVWNSHPKTYG 124 M H +VWNS P+TYG Sbjct: 1 MSHESVWNSRPRTYG 15
BLAST of CK940096 vs. ExPASy Swiss-Prot
Match: RS29_LONON (40S ribosomal protein S29 OS=Lonomia obliqua GN=RpS29 PE=3 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 5.016e-11 Identity = 24/37 (64.86%), Postives = 27/37 (72.97%), Query Frame = 1 Query: 130 SRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFVK 240 SR+CR C N H +IRKYGL CRQCFR A +IGF K Sbjct: 18 SRSCRACSNRHGLIRKYGLNICRQCFREYAHDIGFKK 54 HSP 2 Score: 29.6462 bits (65), Expect = 5.016e-11 Identity = 9/14 (64.29%), Postives = 12/14 (85.71%), Query Frame = 2 Query: 80 MGHSNVWNSHPKTY 121 MGH+N+W SHP+ Y Sbjct: 1 MGHANIWYSHPRRY 14
BLAST of CK940096 vs. ExPASy Swiss-Prot
Match: RS29_MAGGR (40S ribosomal protein S29 OS=Magnaporthe grisea GN=RPS29 PE=3 SV=1) HSP 1 Score: 56.225 bits (134), Expect = 6.515e-11 Identity = 24/39 (61.54%), Postives = 30/39 (76.92%), Query Frame = 1 Query: 130 SRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFVKYR 246 +R+CRVC + +IRKYGL CRQCFR A +IGFVK+R Sbjct: 18 ARSCRVCTHRAGLIRKYGLDICRQCFREKAADIGFVKHR 56 HSP 2 Score: 30.0314 bits (66), Expect = 6.515e-11 Identity = 10/15 (66.67%), Postives = 12/15 (80.00%), Query Frame = 2 Query: 80 MGHSNVWNSHPKTYG 124 M H +VWNS P+TYG Sbjct: 1 MSHDSVWNSRPRTYG 15
BLAST of CK940096 vs. ExPASy Swiss-Prot
Match: RS29_ICTPU (40S ribosomal protein S29 OS=Ictalurus punctatus GN=rps29 PE=3 SV=3) HSP 1 Score: 63.1586 bits (152), Expect = 8.461e-11 Identity = 27/37 (72.97%), Postives = 30/37 (81.08%), Query Frame = 1 Query: 130 SRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFVK 240 SR+CRVC N H +IRKYGL CRQCFR AK+IGFVK Sbjct: 18 SRSCRVCSNRHGLIRKYGLNMCRQCFRQYAKDIGFVK 54 HSP 2 Score: 22.7126 bits (47), Expect = 8.461e-11 Identity = 7/15 (46.67%), Postives = 11/15 (73.33%), Query Frame = 2 Query: 80 MGHSNVWNSHPKTYG 124 MGH ++ SHP+ +G Sbjct: 1 MGHQQLYWSHPRKFG 15
BLAST of CK940096 vs. ExPASy Swiss-Prot
Match: RS29_HIPCM (40S ribosomal protein S29 OS=Hippocampus comes GN=rps29 PE=3 SV=3) HSP 1 Score: 63.1586 bits (152), Expect = 8.461e-11 Identity = 27/37 (72.97%), Postives = 30/37 (81.08%), Query Frame = 1 Query: 130 SRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFVK 240 SR+CRVC N H +IRKYGL CRQCFR AK+IGFVK Sbjct: 18 SRSCRVCSNRHGLIRKYGLNMCRQCFRQYAKDIGFVK 54 HSP 2 Score: 22.7126 bits (47), Expect = 8.461e-11 Identity = 7/15 (46.67%), Postives = 11/15 (73.33%), Query Frame = 2 Query: 80 MGHSNVWNSHPKTYG 124 MGH ++ SHP+ +G Sbjct: 1 MGHQQLYWSHPRKFG 15 The following BLAST results are available for this feature:
BLAST of CK940096 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 15
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CK940096 ID=CK940096; Name=CK940096; organism=Citrus sinensis; type=EST; length=474bpback to top |