CN188516
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CN188516 vs. ExPASy Swiss-Prot
Match: SAP10_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 10 OS=Arabidopsis thaliana GN=SAP10 PE=2 SV=1) HSP 1 Score: 86.2705 bits (212), Expect = 1.793e-16 Identity = 37/71 (52.11%), Postives = 51/71 (71.83%), Query Frame = -3 Query: 269 KEANVEKRVVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKSAGRDAIARENPVIKAAKIVR 481 +E V+KR RC C+RKVG+ GF+CRCG +FCG HRY + H C +DYK +GR A+A + P+I+A K+ R Sbjct: 62 EEEPVKKR---RCGICKRKVGMLGFKCRCGHMFCGSHRYPEEHSCPFDYKQSGRLALATQLPLIRADKLQR 129
BLAST of CN188516 vs. ExPASy Swiss-Prot
Match: SAP10_ORYSJ (Zinc finger A20 and AN1 domain-containing stress-associated protein 10 OS=Oryza sativa subsp. japonica GN=SAP10 PE=2 SV=1) HSP 1 Score: 80.8777 bits (198), Expect = 7.535e-15 Identity = 35/62 (56.45%), Postives = 45/62 (72.58%), Query Frame = -3 Query: 266 NRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKSAGRDAIARENPVIKAAKIVRV 451 NRC CR+KVGL GF CRCG +FCG H C++DYK+AGR+AIAR NP++ A KI ++ Sbjct: 97 NRCKACRKKVGLLGFPCRCGGMFCGAHA------CAFDYKAAGREAIARHNPLVVAPKINKI 152
BLAST of CN188516 vs. ExPASy Swiss-Prot
Match: SAP8_ARATH (Putative zinc finger A20 and AN1 domain-containing stress-associated protein 8 OS=Arabidopsis thaliana GN=SAP8 PE=3 SV=1) HSP 1 Score: 77.411 bits (189), Expect = 8.331e-14 Identity = 31/57 (54.39%), Postives = 40/57 (70.18%), Query Frame = -3 Query: 266 CRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKSAGRDAIARENPVIKAAKIVRV 436 C++KVGL GF CRCG LF HRY + H C DYKSA D +A++NPV+K K+ R+ Sbjct: 69 CKKKVGLLGFHCRCGHLFFASHRYPEEHSCPSDYKSAAIDVLAKQNPVVKGDKLFRL 125
BLAST of CN188516 vs. ExPASy Swiss-Prot
Match: ANUB1_HUMAN (AN1-type zinc finger and ubiquitin domain-containing protein 1 OS=Homo sapiens GN=ANUBL1 PE=2 SV=2) HSP 1 Score: 75.8702 bits (185), Expect = 2.424e-13 Identity = 31/68 (45.59%), Postives = 44/68 (64.71%), Query Frame = -3 Query: 266 EKRVVNRCSGCRRKVGL-TGFRCRCGELFCGEHRYSDRHDCSYDYKSAGRDAIARENPVIKAAKIVRV 466 +K+ N C C +K GL + + CRCG FC HRY++ H C+YDYKSAGR + NPV+ A K+ ++ Sbjct: 660 KKKTTNHCFLCGKKTGLASSYECRCGNNFCASHRYAETHGCTYDYKSAGRRYLHEANPVVNAPKLPKI 727 The following BLAST results are available for this feature:
BLAST of CN188516 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 34
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CN188516 ID=CN188516; Name=CN188516; organism=Citrus sinensis; type=EST; length=714bpback to top |