CK938959
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CK938959 vs. ExPASy Swiss-Prot
Match: RR12_MAIZE (30S ribosomal protein S12, chloroplastic OS=Zea mays GN=rps12-A PE=3 SV=2) HSP 1 Score: 70.0922 bits (170), Expect = 4.021e-12 Identity = 31/38 (81.58%), Postives = 33/38 (86.84%), Query Frame = 2 Query: 86 MPTIKQLIRNPRQPIRNVTKSPALRGCPQRRGTCTRVY 199 MPT+KQLIRN RQPIRN KS AL+GCPQRRGTC RVY Sbjct: 1 MPTVKQLIRNARQPIRNARKSAALKGCPQRRGTCARVY 38
BLAST of CK938959 vs. ExPASy Swiss-Prot
Match: RR12_JASNU (30S ribosomal protein S12, chloroplastic OS=Jasminum nudiflorum GN=rps12-A PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 6.859e-12 Identity = 32/38 (84.21%), Postives = 33/38 (86.84%), Query Frame = 2 Query: 86 MPTIKQLIRNPRQPIRNVTKSPALRGCPQRRGTCTRVY 199 MPTI QLIRN RQ IRNV KSPAL+GCPQRRG CTRVY Sbjct: 1 MPTINQLIRNTRQSIRNVKKSPALQGCPQRRGICTRVY 38
BLAST of CK938959 vs. ExPASy Swiss-Prot
Match: RR12_WHEAT (30S ribosomal protein S12, chloroplastic OS=Triticum aestivum GN=rps12-A PE=3 SV=2) HSP 1 Score: 68.9366 bits (167), Expect = 8.959e-12 Identity = 30/38 (78.95%), Postives = 33/38 (86.84%), Query Frame = 2 Query: 86 MPTIKQLIRNPRQPIRNVTKSPALRGCPQRRGTCTRVY 199 MPT+KQLIRN RQPIRN K+ AL+GCPQRRGTC RVY Sbjct: 1 MPTVKQLIRNARQPIRNARKTAALKGCPQRRGTCARVY 38
BLAST of CK938959 vs. ExPASy Swiss-Prot
Match: RR12_HORVU (30S ribosomal protein S12, chloroplastic OS=Hordeum vulgare GN=rps12-A PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 8.959e-12 Identity = 30/38 (78.95%), Postives = 33/38 (86.84%), Query Frame = 2 Query: 86 MPTIKQLIRNPRQPIRNVTKSPALRGCPQRRGTCTRVY 199 MPT+KQLIRN RQPIRN K+ AL+GCPQRRGTC RVY Sbjct: 1 MPTVKQLIRNARQPIRNARKTAALKGCPQRRGTCARVY 38
BLAST of CK938959 vs. ExPASy Swiss-Prot
Match: RR12_AGRST (30S ribosomal protein S12, chloroplastic OS=Agrostis stolonifera GN=rps12-A PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 8.959e-12 Identity = 30/38 (78.95%), Postives = 33/38 (86.84%), Query Frame = 2 Query: 86 MPTIKQLIRNPRQPIRNVTKSPALRGCPQRRGTCTRVY 199 MPT+KQLIRN RQPIRN K+ AL+GCPQRRGTC RVY Sbjct: 1 MPTVKQLIRNARQPIRNARKTAALKGCPQRRGTCARVY 38
BLAST of CK938959 vs. ExPASy Swiss-Prot
Match: RR12_CHAGL (30S ribosomal protein S12, chloroplastic OS=Chaetosphaeridium globosum GN=rps12 PE=3 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 1.170e-11 Identity = 31/38 (81.58%), Postives = 33/38 (86.84%), Query Frame = 2 Query: 86 MPTIKQLIRNPRQPIRNVTKSPALRGCPQRRGTCTRVY 199 MPTI+QLIRN R+PI N TKSPALR CPQRRG CTRVY Sbjct: 1 MPTIQQLIRNRREPIENRTKSPALRSCPQRRGVCTRVY 38
BLAST of CK938959 vs. ExPASy Swiss-Prot
Match: RR12_STAPU (30S ribosomal protein S12, chloroplastic OS=Staurastrum punctulatum GN=rps12 PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 1.528e-11 Identity = 31/38 (81.58%), Postives = 32/38 (84.21%), Query Frame = 2 Query: 86 MPTIKQLIRNPRQPIRNVTKSPALRGCPQRRGTCTRVY 199 MPTI+QLIRN RQP N TKSPALR CPQRRG CTRVY Sbjct: 1 MPTIQQLIRNSRQPAENRTKSPALRACPQRRGVCTRVY 38
BLAST of CK938959 vs. ExPASy Swiss-Prot
Match: RR12_PINTH (30S ribosomal protein S12, chloroplastic OS=Pinus thunbergii GN=rps12 PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 1.528e-11 Identity = 31/38 (81.58%), Postives = 32/38 (84.21%), Query Frame = 2 Query: 86 MPTIKQLIRNPRQPIRNVTKSPALRGCPQRRGTCTRVY 199 MPTI+QLIRN RQPI N KSPALRGCPQRRG C RVY Sbjct: 1 MPTIQQLIRNARQPIENRKKSPALRGCPQRRGVCARVY 38
BLAST of CK938959 vs. ExPASy Swiss-Prot
Match: RR12_PINCO (30S ribosomal protein S12, chloroplastic (Fragment) OS=Pinus contorta GN=rps12 PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 1.528e-11 Identity = 31/38 (81.58%), Postives = 32/38 (84.21%), Query Frame = 2 Query: 86 MPTIKQLIRNPRQPIRNVTKSPALRGCPQRRGTCTRVY 199 MPTI+QLIRN RQPI N KSPALRGCPQRRG C RVY Sbjct: 1 MPTIQQLIRNARQPIENRKKSPALRGCPQRRGVCARVY 38
BLAST of CK938959 vs. ExPASy Swiss-Prot
Match: RR12_ZYGCR (30S ribosomal protein S12, chloroplastic OS=Zygnema circumcarinatum GN=rps12 PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 2.607e-11 Identity = 30/38 (78.95%), Postives = 33/38 (86.84%), Query Frame = 2 Query: 86 MPTIKQLIRNPRQPIRNVTKSPALRGCPQRRGTCTRVY 199 MPTI+QLIRN RQP +N TKSPAL+ CPQRRG CTRVY Sbjct: 1 MPTIQQLIRNTRQPTQNRTKSPALKACPQRRGVCTRVY 38 The following BLAST results are available for this feature:
BLAST of CK938959 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 82
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CK938959 ID=CK938959; Name=CK938959; organism=Citrus sinensis; type=EST; length=263bpback to top |