CK938959
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CK938959 vs. ExPASy Swiss-Prot
Match: RR12_ANGEV (30S ribosomal protein S12, chloroplastic OS=Angiopteris evecta GN=rps12-A PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 2.607e-11 Identity = 31/38 (81.58%), Postives = 33/38 (86.84%), Query Frame = 2 Query: 86 MPTIKQLIRNPRQPIRNVTKSPALRGCPQRRGTCTRVY 199 M TI+QLIRN RQPI + TKSPALRGCPQRRG CTRVY Sbjct: 1 MSTIQQLIRNTRQPIEDRTKSPALRGCPQRRGVCTRVY 38
BLAST of CK938959 vs. ExPASy Swiss-Prot
Match: RS12_HYPNA (30S ribosomal protein S12 OS=Hyphomonas neptunium (strain ATCC 15444) GN=rpsL PE=3 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 4.446e-11 Identity = 29/38 (76.32%), Postives = 33/38 (86.84%), Query Frame = 2 Query: 86 MPTIKQLIRNPRQPIRNVTKSPALRGCPQRRGTCTRVY 199 MPTI+QLIRNPR+P R TK+PAL+ CPQRRG CTRVY Sbjct: 1 MPTIQQLIRNPREPKRTRTKTPALKACPQRRGVCTRVY 38 The following BLAST results are available for this feature:
BLAST of CK938959 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 82
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CK938959 ID=CK938959; Name=CK938959; organism=Citrus sinensis; type=EST; length=263bpback to top |