CX043405

Overview
NameCX043405
Unique NameCX043405
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length771
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CX043405_ssr96 microsatellite CX043405_ssr96:96..109. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of CX043405 vs. ExPASy Swiss-Prot
Match: DUSA_PSESM (tRNA-dihydrouridine synthase A OS=Pseudomonas syringae pv. tomato GN=dusA PE=3 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 9.884e-35
Identity = 77/176 (43.75%), Postives = 106/176 (60.23%), Query Frame = -2
Query:  198 HPIVLQIGGSNLDNLAKATELANAYNYDEINLNCGCPSPKVAGHGCFGVSLMLDPKFVGEAMSVIAANTNVPVSVKCRIGVDDHDSYNQLCDFIYKVSSLSPTRHFIIHSRKALLNGISPAENRTIPPLKYEYYYALLRDFPDLTFTLNGGINTVDEVNAALRKGAHHVMVGRAAY 725
            HP+ LQ+GGS    LA    LA A  YDE+NLN GCPS +V  +   G  LM  P+ V + +  +     +PV+VK RIG++  DSY +LCDF+  V      + F +H+R A+L G+SP ENR IPPL+Y+    L  DFP+L   LNGGI T+++ +  L+     VM+GR AY
Sbjct:   72 HPLALQLGGSTAAGLAACARLAEAAGYDEVNLNVGCPSDRVQNN-MIGACLMAHPQLVADCVKAMRDAVGIPVTVKHRIGINGRDSYAELCDFVGTVHDAG-CQSFTVHARIAILEGLSPKENRDIPPLRYDVVAQLKTDFPELEIVLNGGIKTLEQCSEHLQT-FDGVMLGREAY 244          
BLAST of CX043405 vs. ExPASy Swiss-Prot
Match: DUSA_PSEAE (tRNA-dihydrouridine synthase A OS=Pseudomonas aeruginosa GN=dusA PE=3 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 4.905e-34
Identity = 78/176 (44.32%), Postives = 103/176 (58.52%), Query Frame = -2
Query:  198 HPIVLQIGGSNLDNLAKATELANAYNYDEINLNCGCPSPKVAGHGCFGVSLMLDPKFVGEAMSVIAANTNVPVSVKCRIGVDDHDSYNQLCDFIYKVSSLSPTRHFIIHSRKALLNGISPAENRTIPPLKYEYYYALLRDFPDLTFTLNGGINTVDEVNAALRKGAHHVMVGRAAY 725
            HP+ LQ+GGS    LA    LA    YDE+NLN GCPS +V  H   G  LM  P  V + +  +     + V+VK RIG++  DSY +LCDF+ +V      R F +H+R A+L G+SP ENR +PPL+YE    L +DFPDL   LNGGI T++     L+     VM+GR AY
Sbjct:   68 HPLALQLGGSVPAELAACARLAEEAGYDEVNLNVGCPSDRVQ-HNMIGACLMGHPALVADCVKAMLDAVEIAVTVKHRIGINGRDSYAELCDFVGQVREAG-CRSFTVHARIAILEGLSPKENREVPPLRYEVAAQLKKDFPDLEIVLNGGIKTLEACREHLQT-FDGVMLGREAY 240          
The following BLAST results are available for this feature:
BLAST of CX043405 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 22
Match NameE-valueIdentityDescription
DUSA_PSESM9.884e-3543.75tRNA-dihydrouridine synthase A OS=Pseudomonas syri... [more]
DUSA_PSEAE4.905e-3444.32tRNA-dihydrouridine synthase A OS=Pseudomonas aeru... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_10H03_g Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07 Citrus sinensis cDNA clone UCRCS07-10H03-P6-1-6.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX043405 ID=CX043405; Name=CX043405; organism=Citrus sinensis; type=EST; length=771bp
TTTAAATCTAAAAAAAAATCTCTATTTATTAGATAATAGAGAATATACAA
AGAAATGAAATGGTGATGCCACATCACCTCCTCAAGTCCCAACTTTATAT
ATATATATAGATTAGAGCAAACAGAAAATCATTTAATGAACAAGACCAGT
TCAAAAGTTTTTGCTGATGTCAGAATCATTCATTATACATACTTCTGGTA
TGCAGCACGTCCAACCATAACATGGTGAGCACCTTTCCTTAGCGCAGCAT
TTACCTCATCAACTGTATTAATGCCTCCATTTAGTGTAAATGTCAAGTCT
GGAAAGTCACGCAAGAGGGCATAATAGTACTCATACTTCAAAGGAGGAAT
TGTTCGATTTTCAGCCGGGCTAATGCCATTGAGCAGTGCCTTCCGTGAAT
GTATGATGAAATGCCTAGTTGGGGATAAAGAAGAGACTTTATAGATGAAA
TCACAGAGCTGATTGTATGAATCGTGATCGTCGACACCAATTCGGCATTT
GACGCTAACAGGAACATTTGTGTTAGCAGCAATTACTGACATTGCCTCGC
CAACAAACTTTGGATCAAGCATAAGACTAACACCAAAGCACCCATGTCCA
GCTACTTTAGGACTAGGACATCCACAATTTAAATTGATTTCATCATAGTT
GTATGCATTGGCAAGTTCAGTCGCTTTGGCCAGGTTATCCAAGTTACTAC
CACCAATTTGAAGGACAATAGGATGCAAATTTCCCTGTTGATAAATAATT
GTCTCAGCTGCAAGCATCTCT
back to top