CK937484
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CK937484 vs. ExPASy Swiss-Prot
Match: Y3218_CUPTR (UPF0161 protein RALTA_A3218 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=RALTA_A3218 PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 5.820e-11 Identity = 28/74 (37.84%), Postives = 45/74 (60.81%), Query Frame = 1 Query: 358 RAALSMLSFYKREISPLMPRSCRYVPTCSEYSMQAYKKYGVVKGTVLTAWRLCRCNPLGGSGFDPPRWFDEESP 579 R L++L YK +SP + CR++PTCS+Y+ A +G +G+ + A RLCRC+P G+DP + ++P Sbjct: 3 RILLALLRVYKIALSPYLGSQCRFLPTCSDYARDAIVHHGAARGSWMAACRLCRCHPFAQGGYDPVPGTEADTP 76
BLAST of CK937484 vs. ExPASy Swiss-Prot
Match: Y2358_LACPL (UPF0161 protein lp_2358 OS=Lactobacillus plantarum GN=lp_2358 PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 5.820e-11 Identity = 31/77 (40.26%), Postives = 43/77 (55.84%), Query Frame = 1 Query: 358 RAALSMLSFYKREISPLMPRSCRYVPTCSEYSMQAYKKYGVVKGTVLTAWRLCRCNPLGGSGFDP-PRWFDEESPPE 585 R + + FY+R S P CRY PTCS Y+++A ++G VKG ++ R+ RC PL GFDP P F P+ Sbjct: 3 RLLMKGIRFYQRAFSAFSPAHCRYYPTCSNYTLEAINRFGAVKGVLMGVARILRCQPLVKGGFDPVPAHFSLRRNPQ 79
BLAST of CK937484 vs. ExPASy Swiss-Prot
Match: Y2236_DESAP (UPF0161 protein Daud_2236 OS=Desulforudis audaxviator (strain MP104C) GN=Daud_2236 PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 5.820e-11 Identity = 27/65 (41.54%), Postives = 43/65 (66.15%), Query Frame = 1 Query: 358 RAALSMLSFYKREISPLMPRSCRYVPTCSEYSMQAYKKYGVVKGTVLTAWRLCRCNPLGGSGFDP 552 + A+ ++ Y+ ISP P +CR+ PTCSEY++QA KYG+++G + R+ RC+P G+DP Sbjct: 6 KLAIGLIKGYQVAISPFFPSTCRFYPTCSEYAVQAIGKYGLMRGGLRAVRRVLRCHPFSPGGYDP 70
BLAST of CK937484 vs. ExPASy Swiss-Prot
Match: Y989_XYLFA (UPF0161 protein XF_0989 OS=Xylella fastidiosa GN=XF_0989 PE=3 SV=2) HSP 1 Score: 67.3958 bits (163), Expect = 7.602e-11 Identity = 30/60 (50.00%), Postives = 40/60 (66.67%), Query Frame = 1 Query: 373 MLSFYKREISPLMPRSCRYVPTCSEYSMQAYKKYGVVKGTVLTAWRLCRCNPLGGSGFDP 552 +L YKR ISPL+ CR+ P+CSEY+M A ++G ++G L A RL RC PL G+DP Sbjct: 12 LLKIYKRLISPLLGPHCRFEPSCSEYAMGAIARFGTLRGIWLAARRLARCQPLQPGGYDP 71
BLAST of CK937484 vs. ExPASy Swiss-Prot
Match: Y8C8_BURXL (UPF0161 protein Bxeno_A4428 OS=Burkholderia xenovorans (strain LB400) GN=Bxeno_A4428 PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 7.602e-11 Identity = 27/65 (41.54%), Postives = 43/65 (66.15%), Query Frame = 1 Query: 367 LSMLSFYKREISPLMPRSCRYVPTCSEYSMQAYKKYGVVKGTVLTAWRLCRCNPLGGSGFD--PP 555 +++L FYK +SP++ CR+ P+CS+Y+ +A + +G +GT L A R+CRC+P G D PP Sbjct: 6 IALLRFYKVAVSPMLGNRCRFYPSCSDYAREAIQYHGAARGTYLAARRICRCHPFSAGGIDLVPP 70
BLAST of CK937484 vs. ExPASy Swiss-Prot
Match: Y528_EXIS2 (UPF0161 protein Exig_0528 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=Exig_0528 PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 7.602e-11 Identity = 31/72 (43.06%), Postives = 44/72 (61.11%), Query Frame = 1 Query: 367 LSMLSFYKREISPLMPRSCRYVPTCSEYSMQAYKKYGVVKGTVLTAWRLCRCNPLGGSGFD-PPRWFDEESP 579 L + FY++ ISP+ P +CR+ PTCS Y +A +K+G ++G LT RL RC P G D P FD ++P Sbjct: 6 LGGIHFYQKVISPMKPATCRFYPTCSHYGKEAIEKHGALRGGYLTTRRLLRCQPFHPGGLDFVPETFDWKAP 77
BLAST of CK937484 vs. ExPASy Swiss-Prot
Match: Y4507_ANADF (UPF0161 protein Anae109_4507 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=Anae109_4507 PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 7.602e-11 Identity = 28/65 (43.08%), Postives = 44/65 (67.69%), Query Frame = 1 Query: 358 RAALSMLSFYKREISPLMPRSCRYVPTCSEYSMQAYKKYGVVKGTVLTAWRLCRCNPLGGSGFDP 552 RA + ++ Y+R +SPL+P +CR+ P+CS Y+ A +++G +KG+ L A RL RC+P G DP Sbjct: 4 RALVFLVRVYQRLVSPLLPPACRFYPSCSAYAATALERHGALKGSALAARRLLRCHPFHPGGIDP 68
BLAST of CK937484 vs. ExPASy Swiss-Prot
Match: Y3987_BURPP (UPF0161 protein Bphyt_3987 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=Bphyt_3987 PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 7.602e-11 Identity = 27/65 (41.54%), Postives = 43/65 (66.15%), Query Frame = 1 Query: 367 LSMLSFYKREISPLMPRSCRYVPTCSEYSMQAYKKYGVVKGTVLTAWRLCRCNPLGGSGFD--PP 555 +++L FYK +SP++ CR+ P+CS+Y+ +A + +G +GT L A R+CRC+P G D PP Sbjct: 6 IALLRFYKVAVSPMLGNRCRFYPSCSDYAREAIQYHGAARGTYLAARRICRCHPFSAGGIDLVPP 70
BLAST of CK937484 vs. ExPASy Swiss-Prot
Match: Y3099_BURP8 (UPF0161 protein Bphy_3099 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=Bphy_3099 PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 7.602e-11 Identity = 28/64 (43.75%), Postives = 42/64 (65.62%), Query Frame = 1 Query: 370 SMLSFYKREISPLMPRSCRYVPTCSEYSMQAYKKYGVVKGTVLTAWRLCRCNPLGGSGFD--PP 555 ++L FYK +SP++ CR+ P+CS+Y+ +A + +G +GT L A RLCRC+P G D PP Sbjct: 7 ALLRFYKIAVSPMLGNRCRFYPSCSDYAREAIQYHGAARGTYLAARRLCRCHPFSAGGIDLVPP 70
BLAST of CK937484 vs. ExPASy Swiss-Prot
Match: Y1627_FINM2 (UPF0161 protein FMG_1627 OS=Finegoldia magna (strain ATCC 29328) GN=FMG_1627 PE=3 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 7.602e-11 Identity = 27/66 (40.91%), Postives = 43/66 (65.15%), Query Frame = 1 Query: 358 RAALSMLSFYKREISPLMPRS-CRYVPTCSEYSMQAYKKYGVVKGTVLTAWRLCRCNPLGGSGFDP 552 + + ++ FY++ ISP + + C+Y PTCS+Y+++A+KK K LT WR+ RCNP G+DP Sbjct: 3 KVMIFLIKFYQKAISPYLGQGKCKYYPTCSQYALEAFKKKPFFKALGLTIWRILRCNPFSKGGYDP 68 The following BLAST results are available for this feature:
BLAST of CK937484 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 226
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CK937484 ID=CK937484; Name=CK937484; organism=Citrus sinensis; type=EST; length=665bpback to top |