EY665863
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY665863 vs. ExPASy Swiss-Prot
Match: CX6B2_BOVIN (Cytochrome c oxidase subunit 6B2 OS=Bos taurus GN=COX6B2 PE=2 SV=1) HSP 1 Score: 72.4034 bits (176), Expect = 3.695e-12 Identity = 27/73 (36.99%), Postives = 45/73 (61.64%), Query Frame = 2 Query: 392 KLETAPADFRFPTTNQTRHCFTRYIEYHRCVAA---KGEGAPECDKFAKYYRALCPSDWIEKWNEQRENGNLS 601 K T P D RFP NQTR+C+ +++YHRC+ +G+ C+ + + Y +LCP W+++W EQ ++G + Sbjct: 13 KWPTPPFDPRFPNQNQTRNCYQNFLDYHRCIKTMNRRGKSTQPCEYYFRVYHSLCPISWVQRWKEQIKDGTFA 85
BLAST of EY665863 vs. ExPASy Swiss-Prot
Match: CX6B1_TARSY (Cytochrome c oxidase subunit 6B1 OS=Tarsius syrichta GN=COX6B1 PE=3 SV=3) HSP 1 Score: 72.4034 bits (176), Expect = 3.695e-12 Identity = 28/68 (41.18%), Postives = 44/68 (64.71%), Query Frame = 2 Query: 398 ETAPADFRFPTTNQTRHCFTRYIEYHRC---VAAKGEGAPECDKFAKYYRALCPSDWIEKWNEQRENG 592 +TAP D RFP NQTR+C+ Y+++HRC + AKG C+ + + Y++LCP W+ W+++R G Sbjct: 13 KTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEG 80
BLAST of EY665863 vs. ExPASy Swiss-Prot
Match: CX6B1_MOUSE (Cytochrome c oxidase subunit 6B1 OS=Mus musculus GN=Cox6b1 PE=1 SV=2) HSP 1 Score: 68.1662 bits (165), Expect = 6.968e-11 Identity = 26/68 (38.24%), Postives = 43/68 (63.24%), Query Frame = 2 Query: 398 ETAPADFRFPTTNQTRHCFTRYIEYHRC---VAAKGEGAPECDKFAKYYRALCPSDWIEKWNEQRENG 592 +TAP D RFP NQT++C+ Y+++HRC + AKG C+ + + Y++LCP W+ W+++ G Sbjct: 13 KTAPFDSRFPNQNQTKNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPVSWVSAWDDRIAEG 80 The following BLAST results are available for this feature:
BLAST of EY665863 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 13
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY665863 ID=EY665863; Name=EY665863; organism=Citrus sinensis; type=EST; length=862bpback to top |