CN186279

Overview
NameCN186279
Unique NameCN186279
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length518
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CN186279_ssr445 microsatellite CN186279_ssr445:445..459. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig10187 contig Csv1_Contig10187:83..600. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN186279 vs. ExPASy Swiss-Prot
Match: SUMO2_MACFA (Small ubiquitin-related modifier 2 OS=Macaca fascicularis GN=SUMO2 PE=3 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.309e-18
Identity = 47/91 (51.65%), Postives = 58/91 (63.74%), Query Frame = -1
Query:  174 DKKP-----VDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 431
            D+KP      + + HINLKV GQDG+ V F+IKR T L KLM AYC+RQ + +  I F FDG+ +    TP +LEMED D ID    QTGG
Sbjct:    3 DEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG 93          
BLAST of CN186279 vs. ExPASy Swiss-Prot
Match: SUMO2_HUMAN (Small ubiquitin-related modifier 2 OS=Homo sapiens GN=SUMO2 PE=1 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.309e-18
Identity = 47/91 (51.65%), Postives = 58/91 (63.74%), Query Frame = -1
Query:  174 DKKP-----VDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 431
            D+KP      + + HINLKV GQDG+ V F+IKR T L KLM AYC+RQ + +  I F FDG+ +    TP +LEMED D ID    QTGG
Sbjct:    3 DEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG 93          
BLAST of CN186279 vs. ExPASy Swiss-Prot
Match: SUMO2_CRIGR (Small ubiquitin-related modifier 2 OS=Cricetulus griseus GN=SUMO2 PE=3 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.309e-18
Identity = 47/91 (51.65%), Postives = 58/91 (63.74%), Query Frame = -1
Query:  174 DKKP-----VDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 431
            D+KP      + + HINLKV GQDG+ V F+IKR T L KLM AYC+RQ + +  I F FDG+ +    TP +LEMED D ID    QTGG
Sbjct:    3 DEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG 93          
BLAST of CN186279 vs. ExPASy Swiss-Prot
Match: SUMO2_CHICK (Small ubiquitin-related modifier 2 OS=Gallus gallus GN=SUMO2 PE=3 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.309e-18
Identity = 47/91 (51.65%), Postives = 58/91 (63.74%), Query Frame = -1
Query:  174 DKKP-----VDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 431
            D+KP      + + HINLKV GQDG+ V F+IKR T L KLM AYC+RQ + +  I F FDG+ +    TP +LEMED D ID    QTGG
Sbjct:    3 DEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG 93          
BLAST of CN186279 vs. ExPASy Swiss-Prot
Match: SUMO2_BOVIN (Small ubiquitin-related modifier 2 OS=Bos taurus GN=SUMO2 PE=3 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.309e-18
Identity = 47/91 (51.65%), Postives = 58/91 (63.74%), Query Frame = -1
Query:  174 DKKP-----VDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 431
            D+KP      + + HINLKV GQDG+ V F+IKR T L KLM AYC+RQ + +  I F FDG+ +    TP +LEMED D ID    QTGG
Sbjct:    3 DEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG 93          
BLAST of CN186279 vs. ExPASy Swiss-Prot
Match: SMO2A_XENLA (Small ubiquitin-related modifier 2-A OS=Xenopus laevis GN=sumo2-A PE=3 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.309e-18
Identity = 47/92 (51.09%), Postives = 58/92 (63.04%), Query Frame = -1
Query:  171 DKKP-----VDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGGA 431
            D KP      + + HINLKV GQDG+ V F+IKR T L KLM AYC+RQ + +  I F FDG+ +    TP +LEMED D ID    QTGG+
Sbjct:    3 DDKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGS 94          
BLAST of CN186279 vs. ExPASy Swiss-Prot
Match: SUMO3_RAT (Small ubiquitin-related modifier 3 OS=Rattus norvegicus GN=Sumo3 PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.709e-18
Identity = 47/90 (52.22%), Postives = 60/90 (66.67%), Query Frame = -1
Query:  174 QEEDKKPVD-QSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 440
            +E+ K+ V  ++ HINLKV GQDG+ V F+IKR T L KLM AYC+RQ + +  I F FDG+ +    TP +LEMED D ID    QTGG
Sbjct:    3 EEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG 92          
BLAST of CN186279 vs. ExPASy Swiss-Prot
Match: SUMO3_HUMAN (Small ubiquitin-related modifier 3 OS=Homo sapiens GN=SUMO3 PE=1 SV=2)

HSP 1 Score: 92.0485 bits (227), Expect = 1.709e-18
Identity = 47/90 (52.22%), Postives = 60/90 (66.67%), Query Frame = -1
Query:  174 QEEDKKPVD-QSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 440
            +E+ K+ V  ++ HINLKV GQDG+ V F+IKR T L KLM AYC+RQ + +  I F FDG+ +    TP +LEMED D ID    QTGG
Sbjct:    3 EEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG 92          
BLAST of CN186279 vs. ExPASy Swiss-Prot
Match: SUMO3_CHICK (Small ubiquitin-related modifier 3 OS=Gallus gallus GN=SUMO3 PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.709e-18
Identity = 47/90 (52.22%), Postives = 60/90 (66.67%), Query Frame = -1
Query:  174 QEEDKKPVD-QSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 440
            +E+ K+ V  ++ HINLKV GQDG+ V F+IKR T L KLM AYC+RQ + +  I F FDG+ +    TP +LEMED D ID    QTGG
Sbjct:    3 EEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINEADTPAQLEMEDEDTIDVFQQQTGG 92          
BLAST of CN186279 vs. ExPASy Swiss-Prot
Match: SUMO2_XENTR (Small ubiquitin-related modifier 2 OS=Xenopus tropicalis GN=sumo2 PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.709e-18
Identity = 47/92 (51.09%), Postives = 58/92 (63.04%), Query Frame = -1
Query:  171 DKKP-----VDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGGA 431
            D KP      + + HINLKV GQDG+ V F+IKR T L KLM AYC+RQ + +  I F FDG+ +    TP +LEMED D ID    QTGG+
Sbjct:    3 DDKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLNKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGS 94          
The following BLAST results are available for this feature:
BLAST of CN186279 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 42
Match NameE-valueIdentityDescription
SUMO2_MACFA1.309e-1851.65Small ubiquitin-related modifier 2 OS=Macaca fasci... [more]
SUMO2_HUMAN1.309e-1851.65Small ubiquitin-related modifier 2 OS=Homo sapiens... [more]
SUMO2_CRIGR1.309e-1851.65Small ubiquitin-related modifier 2 OS=Cricetulus g... [more]
SUMO2_CHICK1.309e-1851.65Small ubiquitin-related modifier 2 OS=Gallus gallu... [more]
SUMO2_BOVIN1.309e-1851.65Small ubiquitin-related modifier 2 OS=Bos taurus G... [more]
SMO2A_XENLA1.309e-1851.09Small ubiquitin-related modifier 2-A OS=Xenopus la... [more]
SUMO3_RAT1.709e-1852.22Small ubiquitin-related modifier 3 OS=Rattus norve... [more]
SUMO3_HUMAN1.709e-1852.22Small ubiquitin-related modifier 3 OS=Homo sapiens... [more]
SUMO3_CHICK1.709e-1852.22Small ubiquitin-related modifier 3 OS=Gallus gallu... [more]
SUMO2_XENTR1.709e-1851.09Small ubiquitin-related modifier 2 OS=Xenopus trop... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0002K11_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002K11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN186279 ID=CN186279; Name=CN186279; organism=Citrus sinensis; type=EST; length=518bp
TTTTTTTTTTTTTTTGATAATAAACCATGACTTAAATTCAAGTTAACTAT
AAGATCCAAGTCATCATTTACAGTAATATTTCCATAGATATAGGCTAATT
TAAAAAACTCAAACATCAAGTCCGCCAGCGATGCTCTAAATATTTCACAC
TGCAGTTAACCGCTTCCAAGCGCACCTCCAGTCTGATGCAGCATTGCATC
AATTTCATCTCCATCCTCCATCTCAAGCTCATCTGGAGTCTGCTCTCCTC
GGAGTCTCCGCCCATCAAACAAGAAAGCAATAGAGTTTAACTCCACCGAC
TGCCGATCACAGTAGGCATTCATGAGCTTTTTCAACTGGGTGCTTCGCTT
AATTCTAAAAAACACCTCATTGCCATCCTGGCCCTTGACTTTGAGGTTAA
TGTGCGCCGACTGATCGACGGGCTTCTTGTCCTCCTCCTGACCACCGCCG
CCGCCGCCGCCACCACCAGTTGCTGACATCCTTACAGGTTGTTAGAATTG
AATTTTACCCTCTCTCCT
back to top