CN186279

Overview
NameCN186279
Unique NameCN186279
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length518
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CN186279_ssr445 microsatellite CN186279_ssr445:445..459. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig10187 contig Csv1_Contig10187:83..600. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN186279 vs. ExPASy Swiss-Prot
Match: SUMO1_PONAB (Small ubiquitin-related modifier 1 OS=Pongo abelii GN=SUMO1 PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 7.181e-17
Identity = 41/87 (47.13%), Postives = 56/87 (64.37%), Query Frame = -1
Query:  174 EDKKPVDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 434
            ED     +  +I LKV GQD +E+ F++K +T LKKL  +YC RQ V +NS+ FLF+G+R+    TP EL ME+ D I+    QTGG
Sbjct:   11 EDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG 97          
BLAST of CN186279 vs. ExPASy Swiss-Prot
Match: SUMO1_PIG (Small ubiquitin-related modifier 1 OS=Sus scrofa GN=SUMO1 PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 7.181e-17
Identity = 41/87 (47.13%), Postives = 56/87 (64.37%), Query Frame = -1
Query:  174 EDKKPVDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 434
            ED     +  +I LKV GQD +E+ F++K +T LKKL  +YC RQ V +NS+ FLF+G+R+    TP EL ME+ D I+    QTGG
Sbjct:   11 EDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG 97          
BLAST of CN186279 vs. ExPASy Swiss-Prot
Match: SUMO1_MOUSE (Small ubiquitin-related modifier 1 OS=Mus musculus GN=Sumo1 PE=1 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 7.181e-17
Identity = 41/87 (47.13%), Postives = 56/87 (64.37%), Query Frame = -1
Query:  174 EDKKPVDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 434
            ED     +  +I LKV GQD +E+ F++K +T LKKL  +YC RQ V +NS+ FLF+G+R+    TP EL ME+ D I+    QTGG
Sbjct:   11 EDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG 97          
BLAST of CN186279 vs. ExPASy Swiss-Prot
Match: SUMO1_HUMAN (Small ubiquitin-related modifier 1 OS=Homo sapiens GN=SUMO1 PE=1 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 7.181e-17
Identity = 41/87 (47.13%), Postives = 56/87 (64.37%), Query Frame = -1
Query:  174 EDKKPVDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 434
            ED     +  +I LKV GQD +E+ F++K +T LKKL  +YC RQ V +NS+ FLF+G+R+    TP EL ME+ D I+    QTGG
Sbjct:   11 EDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG 97          
BLAST of CN186279 vs. ExPASy Swiss-Prot
Match: SUMO1_CHICK (Small ubiquitin-related modifier 1 OS=Gallus gallus GN=SUMO1 PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 7.181e-17
Identity = 41/87 (47.13%), Postives = 56/87 (64.37%), Query Frame = -1
Query:  174 EDKKPVDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 434
            ED     +  +I LKV GQD +E+ F++K +T LKKL  +YC RQ V +NS+ FLF+G+R+    TP EL ME+ D I+    QTGG
Sbjct:   11 EDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRITDNHTPKELGMEEEDVIEVYQEQTGG 97          
BLAST of CN186279 vs. ExPASy Swiss-Prot
Match: SUMO1_BOVIN (Small ubiquitin-related modifier 1 OS=Bos taurus GN=SUMO1 PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 7.181e-17
Identity = 41/87 (47.13%), Postives = 56/87 (64.37%), Query Frame = -1
Query:  174 EDKKPVDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 434
            ED     +  +I LKV GQD +E+ F++K +T LKKL  +YC RQ V +NS+ FLF+G+R+    TP EL ME+ D I+    QTGG
Sbjct:   11 EDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG 97          
BLAST of CN186279 vs. ExPASy Swiss-Prot
Match: SUMO1_CERNI (Small ubiquitin-related modifier 1 OS=Cervus nippon GN=SUMO1 PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 9.379e-17
Identity = 41/87 (47.13%), Postives = 56/87 (64.37%), Query Frame = -1
Query:  174 EDKKPVDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 434
            ED     +  +I LKV GQD +E+ F++K +T LKKL  +YC RQ V +NS+ FLF+G+R+    TP EL ME+ D I+    QTGG
Sbjct:   11 EDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYHEQTGG 97          
BLAST of CN186279 vs. ExPASy Swiss-Prot
Match: SMT3_YEAST (Ubiquitin-like protein SMT3 OS=Saccharomyces cerevisiae GN=SMT3 PE=1 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 9.379e-17
Identity = 44/89 (49.44%), Postives = 63/89 (70.79%), Query Frame = -1
Query:  171 EDKKPVDQSAHINLKVKGQDGN-EVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGGA 434
            E K  V    HINLKV   DG+ E+FF+IK++T L++LM A+  RQ  E++S+ FL+DG R++ +QTP++L+MED D I+A   Q GGA
Sbjct:   13 EVKPEVKPETHINLKVS--DGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGA 99          
BLAST of CN186279 vs. ExPASy Swiss-Prot
Match: SMO1A_XENLA (Small ubiquitin-related modifier 1-A OS=Xenopus laevis GN=sumo1-A PE=1 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 3.564e-16
Identity = 43/86 (50.00%), Postives = 57/86 (66.28%), Query Frame = -1
Query:  174 DKKPVDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 431
            DKK  D   +I LKV GQD +E+ F++K +T LKKL  +Y  RQ V +NS+ FLF+G+R+   QTP EL ME+ D I+    QTGG
Sbjct:   15 DKK--DGGDYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYRQRQGVPMNSLRFLFEGQRISDHQTPKELGMEEEDVIEVYQEQTGG 98          
BLAST of CN186279 vs. ExPASy Swiss-Prot
Match: SUMO4_HUMAN (Small ubiquitin-related modifier 4 OS=Homo sapiens GN=SUMO4 PE=1 SV=2)

HSP 1 Score: 82.8037 bits (203), Expect = 1.037e-15
Identity = 40/81 (49.38%), Postives = 51/81 (62.96%), Query Frame = -1
Query:  174 DQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 416
            + + HINLKV GQDG+ V F+IKR T L KLM AYC+ + + +  I F F G+ + G   P +LEMED D ID     TGG
Sbjct:   13 ENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSMKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGG 93          
The following BLAST results are available for this feature:
BLAST of CN186279 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 42
Match NameE-valueIdentityDescription
SUMO1_PONAB7.181e-1747.13Small ubiquitin-related modifier 1 OS=Pongo abelii... [more]
SUMO1_PIG7.181e-1747.13Small ubiquitin-related modifier 1 OS=Sus scrofa G... [more]
SUMO1_MOUSE7.181e-1747.13Small ubiquitin-related modifier 1 OS=Mus musculus... [more]
SUMO1_HUMAN7.181e-1747.13Small ubiquitin-related modifier 1 OS=Homo sapiens... [more]
SUMO1_CHICK7.181e-1747.13Small ubiquitin-related modifier 1 OS=Gallus gallu... [more]
SUMO1_BOVIN7.181e-1747.13Small ubiquitin-related modifier 1 OS=Bos taurus G... [more]
SUMO1_CERNI9.379e-1747.13Small ubiquitin-related modifier 1 OS=Cervus nippo... [more]
SMT3_YEAST9.379e-1749.44Ubiquitin-like protein SMT3 OS=Saccharomyces cerev... [more]
SMO1A_XENLA3.564e-1650.00Small ubiquitin-related modifier 1-A OS=Xenopus la... [more]
SUMO4_HUMAN1.037e-1549.38Small ubiquitin-related modifier 4 OS=Homo sapiens... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0002K11_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002K11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN186279 ID=CN186279; Name=CN186279; organism=Citrus sinensis; type=EST; length=518bp
TTTTTTTTTTTTTTTGATAATAAACCATGACTTAAATTCAAGTTAACTAT
AAGATCCAAGTCATCATTTACAGTAATATTTCCATAGATATAGGCTAATT
TAAAAAACTCAAACATCAAGTCCGCCAGCGATGCTCTAAATATTTCACAC
TGCAGTTAACCGCTTCCAAGCGCACCTCCAGTCTGATGCAGCATTGCATC
AATTTCATCTCCATCCTCCATCTCAAGCTCATCTGGAGTCTGCTCTCCTC
GGAGTCTCCGCCCATCAAACAAGAAAGCAATAGAGTTTAACTCCACCGAC
TGCCGATCACAGTAGGCATTCATGAGCTTTTTCAACTGGGTGCTTCGCTT
AATTCTAAAAAACACCTCATTGCCATCCTGGCCCTTGACTTTGAGGTTAA
TGTGCGCCGACTGATCGACGGGCTTCTTGTCCTCCTCCTGACCACCGCCG
CCGCCGCCGCCACCACCAGTTGCTGACATCCTTACAGGTTGTTAGAATTG
AATTTTACCCTCTCTCCT
back to top