CN186279
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CN186279 vs. ExPASy Swiss-Prot
Match: SUMO1_DANRE (Small ubiquitin-related modifier 1 OS=Danio rerio GN=sumo1 PE=3 SV=1) HSP 1 Score: 81.6481 bits (200), Expect = 2.310e-15 Identity = 39/77 (50.65%), Postives = 52/77 (67.53%), Query Frame = -1 Query: 174 HINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 404 +I LKV GQD +E+ F++K +T LKKL +Y RQ V +NS+ FLF+G+R+ TP EL MED D I+ QTGG Sbjct: 20 YIKLKVIGQDNSEIHFKVKMTTHLKKLKESYSQRQGVPVNSLRFLFEGQRITDNLTPKELGMEDEDVIEVYQEQTGG 96
BLAST of CN186279 vs. ExPASy Swiss-Prot
Match: SUMO1_ONCMY (Small ubiquitin-related modifier 1 OS=Oncorhynchus mykiss GN=sumo1 PE=3 SV=1) HSP 1 Score: 80.8777 bits (198), Expect = 3.941e-15 Identity = 41/95 (43.16%), Postives = 57/95 (60.00%), Query Frame = -1 Query: 174 EEDKKPVDQSA-------HINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVELNSIAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQTGG 437 + D KP Q +I LKV GQD +E+ F++K +T LKKL +Y RQ V ++++ FLF+G+R+ TP EL MED D I+ QTGG Sbjct: 3 DTDTKPSGQDGGDQKDGEYIKLKVIGQDNSEIHFKVKMTTHLKKLKESYSQRQGVHMSTLRFLFEGQRISDNHTPKELGMEDEDVIEVYQEQTGG 97 The following BLAST results are available for this feature:
BLAST of CN186279 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 42
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CN186279 ID=CN186279; Name=CN186279; organism=Citrus sinensis; type=EST; length=518bpback to top |