CN186268

Overview
NameCN186268
Unique NameCN186268
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length836
Libraries
Library NameType
Washington Navel Orange Stored Fruit Pulp cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1234 contig Csv1_Contig1234:890..1724. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CN186268 vs. ExPASy Swiss-Prot
Match: METK2_ORYSJ (S-adenosylmethionine synthetase 2 OS=Oryza sativa subsp. japonica GN=SAM2 PE=2 SV=1)

HSP 1 Score: 312.768 bits (800), Expect = 1.555e-84
Identity = 156/176 (88.64%), Postives = 162/176 (92.05%), Query Frame = -1
Query:  309 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEK 836
            IKPVIP+KYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY            GKDPTKVDRSGAYI RQAAKSIVA+GLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKE+FDFRPGMMTINLDLKRGGN RF+KTAAYGHFGR+DPDFTWEVVKPLK+EK
Sbjct:  217 IKPVIPDKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIARQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKENFDFRPGMMTINLDLKRGGN-RFIKTAAYGHFGREDPDFTWEVVKPLKYEK 391          
BLAST of CN186268 vs. ExPASy Swiss-Prot
Match: METK_CARPA (S-adenosylmethionine synthetase OS=Carica papaya GN=SAMS PE=2 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 2.031e-84
Identity = 154/171 (90.06%), Postives = 158/171 (92.40%), Query Frame = -1
Query:  324 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKP 836
            IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY            GKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSV+VD+YGTGKIPDKEILKIVKE+FDFRPGM+TINLDLKRGGN RFLKTAAYGHFGRDDPDFTWEVVKP
Sbjct:  215 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVYVDTYGTGKIPDKEILKIVKENFDFRPGMITINLDLKRGGNSRFLKTAAYGHFGRDDPDFTWEVVKP 385          
BLAST of CN186268 vs. ExPASy Swiss-Prot
Match: METK_MEDFA (S-adenosylmethionine synthetase OS=Medicago falcata GN=SAMS PE=2 SV=1)

HSP 1 Score: 311.997 bits (798), Expect = 2.652e-84
Identity = 156/176 (88.64%), Postives = 159/176 (90.34%), Query Frame = -1
Query:  309 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEK 836
            IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY            GKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEIL IVKE+FDFRPGM++INLDLKRGGN RFLKTAAYGHFGRDD DFTWEVVKPLK  K
Sbjct:  217 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILNIVKETFDFRPGMISINLDLKRGGNNRFLKTAAYGHFGRDDADFTWEVVKPLKGGK 392          
BLAST of CN186268 vs. ExPASy Swiss-Prot
Match: METK1_BETVU (S-adenosylmethionine synthetase 1 OS=Beta vulgaris GN=SAMS1 PE=2 SV=1)

HSP 1 Score: 311.612 bits (797), Expect = 3.464e-84
Identity = 153/179 (85.47%), Postives = 163/179 (91.06%), Query Frame = -1
Query:  300 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 836
            IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY            GKDPTKVDRSGAYI RQAAKSIVA+GLARRCIVQ+SYAIGVPEPLSVFVD+YGTGKIPDK+ILKIVKE+FDFRPGM+ INLDL +GG+ R+LKTAAYGHFGRDDPDFTWEVVKPLKW+KPQA
Sbjct:  219 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIARQAAKSIVASGLARRCIVQISYAIGVPEPLSVFVDTYGTGKIPDKDILKIVKETFDFRPGMIAINLDLLKGGS-RYLKTAAYGHFGRDDPDFTWEVVKPLKWDKPQA 396          
BLAST of CN186268 vs. ExPASy Swiss-Prot
Match: METK4_HORVU (S-adenosylmethionine synthetase 4 OS=Hordeum vulgare GN=SAM4 PE=2 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 4.524e-84
Identity = 152/179 (84.92%), Postives = 161/179 (89.94%), Query Frame = -1
Query:  300 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 836
            IKPVIPE+YLDE TIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY            GKDPTKVDRSGAYI RQAAKSIVA+G+ARRCIVQVSYAIGVPEPLSVFVD+YGTGKIPDKEIL+IVKE+FDFRPGM+ INLDLKRGG+GR+LKTAAYGHFGRD  DFTWEVVKPLKWEKP A
Sbjct:  218 IKPVIPEQYLDENTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIARQAAKSIVASGIARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDKEILEIVKENFDFRPGMIIINLDLKRGGSGRYLKTAAYGHFGRDGADFTWEVVKPLKWEKPSA 396          
BLAST of CN186268 vs. ExPASy Swiss-Prot
Match: METK3_ATRNU (S-adenosylmethionine synthetase 3 OS=Atriplex nummularia GN=SAMS3 PE=1 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 1.719e-83
Identity = 154/179 (86.03%), Postives = 160/179 (89.39%), Query Frame = -1
Query:  300 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 836
            IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY            GKDPTKVDRSGAYI RQAAKSIVA GLARRCIVQ+SYAIGVPEPLSVFVD+YGTGKIPDKEILKIVKESFDFRPGM+ INLDL +GG+ R+LKTAAYGHFGRDD DFTWE VKPLKWEKPQA
Sbjct:  219 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIARQAAKSIVAAGLARRCIVQISYAIGVPEPLSVFVDTYGTGKIPDKEILKIVKESFDFRPGMIAINLDLLKGGS-RYLKTAAYGHFGRDDADFTWETVKPLKWEKPQA 396          
BLAST of CN186268 vs. ExPASy Swiss-Prot
Match: METK_WHEAT (S-adenosylmethionine synthetase OS=Triticum aestivum GN=SAMS PE=2 SV=1)

HSP 1 Score: 308.916 bits (790), Expect = 2.245e-83
Identity = 150/179 (83.80%), Postives = 160/179 (89.39%), Query Frame = -1
Query:  300 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 836
            IKPVIPE+YLDE TIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY            GKDPTKVDRSGAY+ RQAAKSIVA+G+ARRCIVQVSYAIGVPEPLSVFVD+YGTGKIPDKEIL+IVKE+FDFRPGM+ INLDLKRGG GR+LKTAAYGHFGR+  DFTWEVVKPLKWEKP A
Sbjct:  218 IKPVIPEQYLDENTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYVARQAAKSIVASGIARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDKEILEIVKENFDFRPGMIIINLDLKRGGKGRYLKTAAYGHFGREGADFTWEVVKPLKWEKPSA 396          
BLAST of CN186268 vs. ExPASy Swiss-Prot
Match: METK4_ATRNU (S-adenosylmethionine synthetase 4 OS=Atriplex nummularia GN=SAMS4 PE=1 SV=1)

HSP 1 Score: 308.145 bits (788), Expect = 3.829e-83
Identity = 153/179 (85.47%), Postives = 160/179 (89.39%), Query Frame = -1
Query:  300 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 836
            IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY            GKDPTKVDRSGAYI RQAAKSIVA GLARRCIVQ+SYAIGVPEPLSVFVD+YGTGKIPDKEILKIVKE+FDFRPGM+ INLDL +GG+ R+LKTAAYGHFGRDD DFTWE VKPLKWEKPQA
Sbjct:  219 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIARQAAKSIVAAGLARRCIVQISYAIGVPEPLSVFVDTYGTGKIPDKEILKIVKETFDFRPGMIAINLDLLKGGS-RYLKTAAYGHFGRDDADFTWETVKPLKWEKPQA 396          
BLAST of CN186268 vs. ExPASy Swiss-Prot
Match: METK2_ATRNU (S-adenosylmethionine synthetase 2 OS=Atriplex nummularia GN=SAMS2 PE=1 SV=1)

HSP 1 Score: 308.145 bits (788), Expect = 3.829e-83
Identity = 153/179 (85.47%), Postives = 160/179 (89.39%), Query Frame = -1
Query:  300 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 836
            IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY            GKDPTKVDRSGAYI RQAAKSIVA GLARRCIVQ+SYAIGVPEPLSVFVD+YGTGKIPDKEILKIVKE+FDFRPGM+ INLDL +GG+ R+LKTAAYGHFGRDD DFTWE VKPLKWEKPQA
Sbjct:  219 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIARQAAKSIVAAGLARRCIVQISYAIGVPEPLSVFVDTYGTGKIPDKEILKIVKETFDFRPGMIAINLDLLKGGS-RYLKTAAYGHFGRDDADFTWETVKPLKWEKPQA 396          
BLAST of CN186268 vs. ExPASy Swiss-Prot
Match: METK1_ATRNU (S-adenosylmethionine synthetase 1 OS=Atriplex nummularia GN=SAMS1 PE=1 SV=2)

HSP 1 Score: 308.145 bits (788), Expect = 3.829e-83
Identity = 153/179 (85.47%), Postives = 160/179 (89.39%), Query Frame = -1
Query:  300 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYXXXXXXXXXXXXGKDPTKVDRSGAYIVRQAAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 836
            IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTY            GKDPTKVDRSGAYI RQAAKSIVA GLARRCIVQ+SYAIGVPEPLSVFVD+YGTGKIPDKEILKIVKE+FDFRPGM+ INLDL +GG+ R+LKTAAYGHFGRDD DFTWE VKPLKWEKPQA
Sbjct:  219 IKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIARQAAKSIVAAGLARRCIVQISYAIGVPEPLSVFVDTYGTGKIPDKEILKIVKETFDFRPGMIAINLDLLKGGS-RYLKTAAYGHFGRDDADFTWETVKPLKWEKPQA 396          
The following BLAST results are available for this feature:
BLAST of CN186268 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK2_ORYSJ1.555e-8488.64S-adenosylmethionine synthetase 2 OS=Oryza sativa ... [more]
METK_CARPA2.031e-8490.06S-adenosylmethionine synthetase OS=Carica papaya G... [more]
METK_MEDFA2.652e-8488.64S-adenosylmethionine synthetase OS=Medicago falcat... [more]
METK1_BETVU3.464e-8485.47S-adenosylmethionine synthetase 1 OS=Beta vulgaris... [more]
METK4_HORVU4.524e-8484.92S-adenosylmethionine synthetase 4 OS=Hordeum vulga... [more]
METK3_ATRNU1.719e-8386.03S-adenosylmethionine synthetase 3 OS=Atriplex numm... [more]
METK_WHEAT2.245e-8383.80S-adenosylmethionine synthetase OS=Triticum aestiv... [more]
METK4_ATRNU3.829e-8385.47S-adenosylmethionine synthetase 4 OS=Atriplex numm... [more]
METK2_ATRNU3.829e-8385.47S-adenosylmethionine synthetase 2 OS=Atriplex numm... [more]
METK1_ATRNU3.829e-8385.47S-adenosylmethionine synthetase 1 OS=Atriplex numm... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS05_0002K05_f Washington Navel Orange Stored Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0002K05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CN186268 ID=CN186268; Name=CN186268; organism=Citrus sinensis; type=EST; length=836bp
TTTTTTTTTTTTTAGCAAAAGGAAGAATTTTACTAATTCCAGGCACCTTT
TTGAGCAAAATTCTCAATCGATATCACTACACAACAGTGGTGACATGGTA
CATTAAACCAAAACCAAAAAAGAAGTGGGGAAAGAAGAAAAAGAAAGGAA
TTGAATGGGGAACATGTATGAGTTCTGAACACAGGAGATTTGCTTAGTAT
TACAAAGCAGCAGCAAGATAATATTCAAATTATTCATCCACTACCAATAG
AAGCAAACTTGAACAGCAGGGATAGTTTTCACTTTTCAACTCAAATTTAA
GCTTGAGGCTTTTCCCACTTGAGGGGCTTCACAACTTCCCAAGTGAAGTC
TGGGTCATCCCTGCCAAAGTGTCCATAGGCAGCAGTCTTCAAGAACCTGC
CATTACCGCCCCTTTTGAGATCCAAATTGATGGTCATCATTCCTGGCCTG
AAATCAAAGCTTTCCTTCACAATTTTGAGGATCTCCTTGTCAGGAATCTT
GCCGGTTCCATATGAGTCCACAAAAACAGACAATGGCTCAGGCACACCAA
TGGCATAGGAGACTTGGACAATGCACCTGCGAGCAAGCCCGTTTGCAACA
ATGCTCTTAGCAGCCTGCCTAACAATGTATGCACCACTCCTATCCACCTT
AGTAGGGTCTTTTCCAGAGAAAGCACCGCCACCATGGGCTCCCCAGCCAC
CATAAGTGTCGATGATGATCTTACGTCCAGTGAGACCAGCATCACCATGA
GGCCCACCAATGACAAAACGACCTGATGGATTAAGGTGGAAGATGGTCTT
CTCATCAAGGTACTTCTCGGGGATGACAGGCTTAAT
back to top