CN186220
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CN186220 vs. ExPASy Swiss-Prot
Match: SPT4H_XENLA (Transcription elongation factor SPT4 OS=Xenopus laevis GN=supt4h1 PE=3 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 7.727e-13 Identity = 34/87 (39.08%), Postives = 51/87 (58.62%), Query Frame = 2 Query: 5 VKTYDQFRESGCHICP-FFKMDEDHERVVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPEDLQNLCEDERVQY 262 VKT DQF GC C + +M + E V DCT+ +F+GI+++M P SW ++W RI F PG Y ++V+ LP+ + + V Y Sbjct: 22 VKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIVAMMSPDDSWVSKWQRITNFKPGVYAVSVTGRLPQGIVRELKSRGVVY 108
BLAST of CN186220 vs. ExPASy Swiss-Prot
Match: SPT4H_DROME (Transcription elongation factor SPT4 OS=Drosophila melanogaster GN=spt4 PE=1 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 7.727e-13 Identity = 33/74 (44.59%), Postives = 47/74 (63.51%), Query Frame = 2 Query: 5 VKTYDQFRESGCHICP-FFKMDEDHERVVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPE 223 VK++DQF GC C F +M + + V D T+ NF+GII++ PT SW A+W R+ RF G Y ++VS LP+ Sbjct: 22 VKSFDQFETDGCENCEEFLRMKNNKDNVYDHTSNNFDGIIALTTPTDSWVAKWQRLSRFTRGIYAISVSGTLPQ 95
BLAST of CN186220 vs. ExPASy Swiss-Prot
Match: SPT42_MOUSE (Transcription elongation factor SPT4 2 OS=Mus musculus GN=Supt4h2 PE=2 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 2.248e-12 Identity = 33/87 (37.93%), Postives = 50/87 (57.47%), Query Frame = 2 Query: 5 VKTYDQFRESGCHICP-FFKMDEDHERVVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPEDLQNLCEDERVQY 262 VKT DQF GC C + +M + E V DCT+ +F+GI ++M P SW ++W R+ F PG Y ++V+ LP+ + + V Y Sbjct: 22 VKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGINAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAY 108
BLAST of CN186220 vs. ExPASy Swiss-Prot
Match: SPT4_ASPFU (Transcription elongation factor spt4 OS=Aspergillus fumigatus GN=spt4 PE=3 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 3.246e-11 Identity = 30/89 (33.71%), Postives = 53/89 (59.55%), Query Frame = 2 Query: 5 VKTYDQFRESGCHICP-FFKMDEDHERVVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPEDLQNLCEDERVQYVP 268 V+ + +F GC C + +++ + +CT+ F G+I++ DP+ SW ARW R+ +V G Y + V+ +LP+D+ ED V+Y+P Sbjct: 24 VQLHSKFMRDGCPNCDNVLGLRGNNDAIQECTSQVFEGLITLRDPSTSWVARWQRLEGYVAGTYAVKVTGSLPDDVITNLEDSGVRYIP 112
BLAST of CN186220 vs. ExPASy Swiss-Prot
Match: SPT4H_CAEEL (Transcription elongation factor SPT4 OS=Caenorhabditis elegans GN=spt-4 PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 3.246e-11 Identity = 31/92 (33.70%), Postives = 53/92 (57.61%), Query Frame = 2 Query: 5 VKTYDQFRESGCHICP-FFKMDEDHERVVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPEDLQNLCEDERVQYVPPKR 277 VK+ + F++ GC C + D E+V DCT+ N++G+I+ M SW +W ++ R V G Y ++VS LP ++ + + V+Y P +R Sbjct: 21 VKSVESFQKEGCENCEDVLHLKGDEEKVYDCTSANYDGMIAAMSNNESWVCKWQKMQRKVKGMYAISVSGVLPNNIVSELKSLGVRYKPNQR 112 The following BLAST results are available for this feature:
BLAST of CN186220 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 15
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CN186220 ID=CN186220; Name=CN186220; organism=Citrus sinensis; type=EST; length=503bpback to top |