CN186219
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CN186219 vs. ExPASy Swiss-Prot
Match: SPT4H_DANRE (Transcription elongation factor SPT4 OS=Danio rerio GN=supt4h1 PE=3 SV=1) HSP 1 Score: 78.1814 bits (191), Expect = 2.402e-14 Identity = 34/73 (46.58%), Postives = 48/73 (65.75%), Query Frame = -1 Query: 285 VKTYDQFRESGCENCP-FFKMDEDHERVVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALP 500 VKT DQF GC+NC + +M + E V +CT+ +F+G+I++M P SW A+W RIG F PG Y + V+ LP Sbjct: 22 VKTIDQFEYDGCDNCESYLQMKGNREMVYECTSSSFDGVIAMMSPEDSWVAKWQRIGNFKPGVYAVTVTGRLP 94
BLAST of CN186219 vs. ExPASy Swiss-Prot
Match: SPT4H_XENLA (Transcription elongation factor SPT4 OS=Xenopus laevis GN=supt4h1 PE=3 SV=1) HSP 1 Score: 77.7962 bits (190), Expect = 3.137e-14 Identity = 35/87 (40.23%), Postives = 53/87 (60.92%), Query Frame = -1 Query: 243 VKTYDQFRESGCENCP-FFKMDEDHERVVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPEDLQNLCEDERVQY 500 VKT DQF GC+NC + +M + E V DCT+ +F+GI+++M P SW ++W RI F PG Y ++V+ LP+ + + V Y Sbjct: 22 VKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIVAMMSPDDSWVSKWQRITNFKPGVYAVSVTGRLPQGIVRELKSRGVVY 108
BLAST of CN186219 vs. ExPASy Swiss-Prot
Match: SPT42_MOUSE (Transcription elongation factor SPT4 2 OS=Mus musculus GN=Supt4h2 PE=2 SV=1) HSP 1 Score: 76.2554 bits (186), Expect = 9.127e-14 Identity = 34/87 (39.08%), Postives = 52/87 (59.77%), Query Frame = -1 Query: 243 VKTYDQFRESGCENCP-FFKMDEDHERVVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPEDLQNLCEDERVQY 500 VKT DQF GC+NC + +M + E V DCT+ +F+GI ++M P SW ++W R+ F PG Y ++V+ LP+ + + V Y Sbjct: 22 VKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGINAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAY 108
BLAST of CN186219 vs. ExPASy Swiss-Prot
Match: SPT4H_CAEEL (Transcription elongation factor SPT4 OS=Caenorhabditis elegans GN=spt-4 PE=2 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 7.727e-13 Identity = 33/92 (35.87%), Postives = 55/92 (59.78%), Query Frame = -1 Query: 228 VKTYDQFRESGCENCP-FFKMDEDHERVVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPEDLQNLCEDERVQYVPPKR 500 VK+ + F++ GCENC + D E+V DCT+ N++G+I+ M SW +W ++ R V G Y ++VS LP ++ + + V+Y P +R Sbjct: 21 VKSVESFQKEGCENCEDVLHLKGDEEKVYDCTSANYDGMIAAMSNNESWVCKWQKMQRKVKGMYAISVSGVLPNNIVSELKSLGVRYKPNQR 112
BLAST of CN186219 vs. ExPASy Swiss-Prot
Match: SPT4_ASPFU (Transcription elongation factor spt4 OS=Aspergillus fumigatus GN=spt4 PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 2.248e-12 Identity = 31/89 (34.83%), Postives = 54/89 (60.67%), Query Frame = -1 Query: 237 VKTYDQFRESGCENCP-FFKMDEDHERVVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPEDLQNLCEDERVQYVP 500 V+ + +F GC NC + +++ + +CT+ F G+I++ DP+ SW ARW R+ +V G Y + V+ +LP+D+ ED V+Y+P Sbjct: 24 VQLHSKFMRDGCPNCDNVLGLRGNNDAIQECTSQVFEGLITLRDPSTSWVARWQRLEGYVAGTYAVKVTGSLPDDVITNLEDSGVRYIP 112
BLAST of CN186219 vs. ExPASy Swiss-Prot
Match: SPT4H_CAEBR (Transcription elongation factor SPT4 OS=Caenorhabditis briggsae GN=spt-4 PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 1.457e-11 Identity = 32/92 (34.78%), Postives = 54/92 (58.70%), Query Frame = -1 Query: 228 VKTYDQFRESGCENCP-FFKMDEDHERVVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPEDLQNLCEDERVQYVPPKR 500 +K+ D F+ GCENC + D E+V DCT+ N++G+I+ M SW +W ++ R V G Y ++VS +LP ++ + + V+Y +R Sbjct: 21 IKSVDAFQTDGCENCDEVLHLKGDEEKVYDCTSANYDGMIAAMSNDDSWVCKWQKMQRRVKGIYAISVSGSLPSNVVSDLKSMGVRYKANQR 112
BLAST of CN186219 vs. ExPASy Swiss-Prot
Match: SPT4_ASHGO (Transcription elongation factor SPT4 OS=Ashbya gossypii GN=SPT4 PE=3 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 1.903e-11 Identity = 27/78 (34.62%), Postives = 48/78 (61.54%), Query Frame = -1 Query: 267 VKTYDQFRESGCENCPFFKMDEDHERVVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPEDLQNL 500 V+T ++F GC NC +E ++CT+P+F G++ + PT+SW A+W+ + ++VPG Y + V LP ++ +L Sbjct: 13 VQTTNEFTRDGCPNCQGI-FEEASVSAIECTSPSFEGLVGMCKPTKSWVAKWISVEQYVPGMYAIKVDGRLPVEVVDL 89
BLAST of CN186219 vs. ExPASy Swiss-Prot
Match: SPT4_KLULA (Transcription elongation factor SPT4 OS=Kluyveromyces lactis GN=SPT4 PE=3 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 9.445e-11 Identity = 27/78 (34.62%), Postives = 46/78 (58.97%), Query Frame = -1 Query: 267 VKTYDQFRESGCENCPFFKMDEDHERVVDCTTPNFNGIISVMDPTRSWAARWLRIGRFVPGCYTLAVSEALPEDLQNL 500 V++ +F +GC NC +E V+CT+P+F G++ + P+RSW ARW+ I ++PG Y + + LP ++ L Sbjct: 13 VQSTAEFNRNGCPNCQSI-FEEAGVSAVECTSPSFEGLVGMCKPSRSWVARWMSIDSYIPGMYAVKIDGRLPIEVTEL 89 The following BLAST results are available for this feature:
BLAST of CN186219 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 18
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CN186219 ID=CN186219; Name=CN186219; organism=Citrus sinensis; type=EST; length=503bpback to top |