CV998078

Overview
NameCV998078
Unique NameCV998078
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length991
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10123 contig Csv1_Contig10123:852..1843. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CV998078 vs. ExPASy Swiss-Prot
Match: AAT_MYCBO (Probable aspartate aminotransferase OS=Mycobacterium bovis GN=aspC PE=3 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.160e-15
Identity = 72/255 (28.24%), Postives = 112/255 (43.92%), Query Frame = -3
Query:  135 RALVVINPGNPTGQVLAEENQRAIVEFCKKEGLVLLADEVYQENVYVPEKKFHSFKKVSRSMGYGEKDISLVSFQSVSKGYYGECGKRGGYMEVTG---FSAEVREQIYKVASVNLCSNISGQILASLVMSPPKVGDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPXXXXXXXXXXKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDF 890
            +ALVVINP NPTG V + E    +V+  +K  L+LLADE+Y + +Y   K          S+     D+  ++F  +SK  Y   G R G++ +TG    ++   E I  +A++ LC N+  Q    + +     G +S E        +L     +        N + G++C K  GA+Y FPR+                 D      LL +  I++  G+GF   P   H R   LP    + A + RL +F
Sbjct:  195 KALVVINPNNPTGAVYSCEILTQMVDLARKHQLLLLADEIYDKILYDDAKHI--------SLASIAPDMLCLTFNGLSKA-YRVAGYRAGWLAITGPKEHASSFIEGIGLLANMRLCPNVPAQHAIQVALG----GHQSIEDLVLPGGRLL----EQRDIAWTKLNEIPGVSCVKPAGALYAFPRLD--------PEVYDIDDDEQLVLDLLLSEKILVTQGTGFNW-PAPDHLRLVTLPWSRDLAAAIERLGNF 423          
BLAST of CV998078 vs. ExPASy Swiss-Prot
Match: YUGH_BACSU (Putative aminotransferase yugH OS=Bacillus subtilis GN=yugH PE=3 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 9.190e-13
Identity = 64/255 (25.10%), Postives = 108/255 (42.35%), Query Frame = -3
Query:  129 RALVVINPGNPTGQVLAEENQRAIVEFCKKEGLVLLADEVYQENVYVPEKKFHSFKKVSRSMGYGEKDISLVSFQSVSKGYYGECGKRGGYMEVTGFSAEVREQIYKVASVNLCSNISGQILASLVMSPPKVGDESYESYCAERDGILSSLARRAKTLEDAFNSLEGITCNKAEGAMYLFPRIQLPXXXXXXXXXXKTVPDAFYCRRLLNATGIVLVPGSGFGQVPGTWHFRCTILPQEDKIPAIVTRLTDF-HK 890
            +A+++ +P NPTG V ++E    I EF KK  +++LADE+Y E  Y  E     F  ++   G  E+ + +  F       +   G R G+        +   +I++ A   +C+    Q  A   +   K G E  E        +  S  RR     ++ N + G++C+   GA Y FP I+              +    +   LL    + +VPGS FG   G  + RC+     +++   + R+  F HK
Sbjct:  164 KAILICSPSNPTGSVYSKEELNEIAEFAKKHDVIVLADEIYAELTYDEE-----FTSIAALPGMKERTVVISGFSKA----FAMTGWRLGFAAAPSLLRDAMLKIHQYAM--MCAPAMAQFAA---LEGLKNGMEDVEK-------MKKSYRRRRNLFVESLNEI-GLSCHHPGGAFYAFPSIK-----------SMGMSSEQFAEELLTQEKVAVVPGSVFGP-SGEGYIRCSYATSIEQLQEALVRMKRFLHK 384          
The following BLAST results are available for this feature:
BLAST of CV998078 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 22
Match NameE-valueIdentityDescription
AAT_MYCBO1.160e-1528.24Probable aspartate aminotransferase OS=Mycobacteri... [more]
YUGH_BACSU9.190e-1325.10Putative aminotransferase yugH OS=Bacillus subtili... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_CTMN-5_T7 Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07-153 Citrus sinensis cDNA clone TC35_C05_043, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CV998078 ID=CV998078|Name=CV998078|organism=Citrus sinensis|type=EST|length=991bp
GTACGCTTTGTCCATTCACTCTGTAAACGTTTAACAATTGAAATGAATGG
CTACACATTATTTTTCTGAACTCAGTCTCATATTATTATGCAGAAGATCT
TTCAATTACGGAATTTGTCCATGAAATTTTTATGGAAGTCTGTCAGCCGG
GTCACAATCGCTGGAATCTTGTCCTCTTGAGGCAATATGGTGCACCTAAA
ATGCCAAGTGCCGGGGACCTGCCCAAAACCAGAACCAGGAACAAGAACAA
TTCCAGTGGCATTGAGAAGGCGGCGACAATAAAATGCATCTGGAACAGTT
TTTTCAGCTTCAGCAGCTTTAATTGCCTTTTCAGGCAGTTGAATACGAGG
AAAGAGATACATTGCTCCTTCAGCCTTGTTACATGTTATTCCTTCCAAAC
TGTTAAATGCATCTTCCAATGTCTTTGCACGCCTGGCTAAAGATGAGAGG
ATTCCATCCCTCTCAGCGCAATAGGACTCATAAGATTCATCTCCAACCTT
AGGTGGACTCATGACAAGGCTTGCCAGAATTTGGCCGGAGATATTAGAAC
AAAGATTCACAGATGCCACTTTGTATATTTGCTCCCTTACTTCAGCACTG
AACCCAGTGACCTCCATGTAACCTCCTCTTTTTCCACACTCCCCATAGTA
ACCTTTAGAAACTGACTGAAATGATACAAGGGATATATCCTTCTCACCAT
ACCCCATGGATCGGGATACCTTCTTAAAGGAATGGAATTTTTTCTCTGGC
ACATAAACATTTTCCTGGTATACCTCATCTGCAAGAAGAACAAGACCCTC
CTTTTTGCAGAACTCCACAATTGCACGCTGGTTTTCTTCAGCAAGAACCT
GTCCAGTTGGATTGCCTGGATTTATTACAACCAAGGCCCTAACGGTAATA
CCTTTGGCCTTGGCGGCCTCCCATTGCTTCTTAACCTCCGAAGTTTCAAT
CCCCATCCTGTTGCTTCATCTAGGTAGTAAGGCACCAAGGT
back to top