EL492485
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EL492485 vs. ExPASy Swiss-Prot
Match: UBC2_YEAST (Ubiquitin-conjugating enzyme E2 2 OS=Saccharomyces cerevisiae GN=RAD6 PE=1 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 8.928e-12 Identity = 28/53 (52.83%), Postives = 39/53 (73.58%), Query Frame = 1 Query: 22 IMGPSDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL 180 I+GP+D+PY G F + + F +YP KPP V F +++FHPN+ +NG ICLDIL Sbjct: 40 IIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMFHPNVYANGEICLDIL 92
BLAST of EL492485 vs. ExPASy Swiss-Prot
Match: UBC2_KLULA (Ubiquitin-conjugating enzyme E2 2 OS=Kluyveromyces lactis GN=UBC2 PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 8.928e-12 Identity = 28/53 (52.83%), Postives = 39/53 (73.58%), Query Frame = 1 Query: 22 IMGPSDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL 180 I+GP+D+PY G F + + F +YP KPP V F +++FHPN+ +NG ICLDIL Sbjct: 40 IIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMFHPNVYANGEICLDIL 92
BLAST of EL492485 vs. ExPASy Swiss-Prot
Match: UBC2_ASHGO (Ubiquitin-conjugating enzyme E2 2 OS=Ashbya gossypii GN=UBC2 PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 8.928e-12 Identity = 28/53 (52.83%), Postives = 39/53 (73.58%), Query Frame = 1 Query: 22 IMGPSDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL 180 I+GP+D+PY G F + + F +YP KPP V F +++FHPN+ +NG ICLDIL Sbjct: 40 IIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMFHPNVYANGEICLDIL 92
BLAST of EL492485 vs. ExPASy Swiss-Prot
Match: UBE2T_MOUSE (Ubiquitin-conjugating enzyme E2 T OS=Mus musculus GN=Ube2t PE=2 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 1.166e-11 Identity = 29/57 (50.88%), Postives = 42/57 (73.68%), Query Frame = 1 Query: 10 LASTIMGPSDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL 180 L + I+G +++PY GVF + + P YPF+PP+V F T ++HPNI+S+G ICLDIL Sbjct: 34 LRAQILGGANTPYEKGVFTLEVIIPERYPFEPPQVRFLTPIYHPNIDSSGRICLDIL 90
BLAST of EL492485 vs. ExPASy Swiss-Prot
Match: UBE2N_RAT (Ubiquitin-conjugating enzyme E2 N OS=Rattus norvegicus GN=Ube2n PE=1 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 1.166e-11 Identity = 28/53 (52.83%), Postives = 36/53 (67.92%), Query Frame = 1 Query: 22 IMGPSDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL 180 I GP DSP+ GG F + + P +YP PKV F TK++HPN++ G ICLDIL Sbjct: 39 IAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDIL 91
BLAST of EL492485 vs. ExPASy Swiss-Prot
Match: UBE2N_PONAB (Ubiquitin-conjugating enzyme E2 N OS=Pongo abelii GN=UBE2N PE=2 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 1.166e-11 Identity = 28/53 (52.83%), Postives = 36/53 (67.92%), Query Frame = 1 Query: 22 IMGPSDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL 180 I GP DSP+ GG F + + P +YP PKV F TK++HPN++ G ICLDIL Sbjct: 39 IAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDIL 91
BLAST of EL492485 vs. ExPASy Swiss-Prot
Match: UBE2N_MOUSE (Ubiquitin-conjugating enzyme E2 N OS=Mus musculus GN=Ube2n PE=1 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 1.166e-11 Identity = 28/53 (52.83%), Postives = 36/53 (67.92%), Query Frame = 1 Query: 22 IMGPSDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL 180 I GP DSP+ GG F + + P +YP PKV F TK++HPN++ G ICLDIL Sbjct: 39 IAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDIL 91
BLAST of EL492485 vs. ExPASy Swiss-Prot
Match: UBE2N_HUMAN (Ubiquitin-conjugating enzyme E2 N OS=Homo sapiens GN=UBE2N PE=1 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 1.166e-11 Identity = 28/53 (52.83%), Postives = 36/53 (67.92%), Query Frame = 1 Query: 22 IMGPSDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL 180 I GP DSP+ GG F + + P +YP PKV F TK++HPN++ G ICLDIL Sbjct: 39 IAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDIL 91
BLAST of EL492485 vs. ExPASy Swiss-Prot
Match: UBE2N_BOVIN (Ubiquitin-conjugating enzyme E2 N OS=Bos taurus GN=UBE2N PE=2 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 1.166e-11 Identity = 28/53 (52.83%), Postives = 36/53 (67.92%), Query Frame = 1 Query: 22 IMGPSDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDIL 180 I GP DSP+ GG F + + P +YP PKV F TK++HPN++ G ICLDIL Sbjct: 39 IAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDIL 91
BLAST of EL492485 vs. ExPASy Swiss-Prot
Match: UBC21_ARATH (Probable ubiquitin carrier protein E2 21 OS=Arabidopsis thaliana GN=UBC21 PE=1 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 1.166e-11 Identity = 30/54 (55.56%), Postives = 38/54 (70.37%), Query Frame = 1 Query: 22 IMGPSDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNIN-SNGSICLDIL 180 I GPS++PY GGVF + P YP +PP+V F TK+FHPN++ G ICLDIL Sbjct: 41 IKGPSETPYEGGVFQLAFSVPEPYPLQPPQVRFLTKIFHPNVHFKTGEICLDIL 94 The following BLAST results are available for this feature:
BLAST of EL492485 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 121
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EL492485 ID=EL492485; Name=EL492485; organism=Citrus sinensis; type=EST; length=195bpback to top |