EY665459

Overview
NameEY665459
Unique NameEY665459
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length834
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665459 vs. ExPASy Swiss-Prot
Match: FTSH_BUCAP (Cell division protease ftsH OS=Buchnera aphidicola subsp. Schizaphis graminum GN=ftsH PE=3 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 4.377e-61
Identity = 100/146 (68.49%), Postives = 121/146 (82.88%), Query Frame = 2
Query:    8 VRFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVXXXXXXXXXXXNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRAWTF 445
            V +LK+P RF  +G +IPKG+L+VGPPGTGKTLLAKAIAGEA VPFF+ISGS+FVEMFVGVGASRVRD+F+ A+++APCI+F+DEIDAV           +DEREQTLNQ+L EMDGF+GN G+I+IAATNR D+LD ALLR   F
Sbjct:  168 VEYLKEPSRFQKLGGKIPKGILMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFEHARKSAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFDGNEGVILIAATNRPDVLDPALLRPGRF 313          

HSP 2 Score: 49.6766 bits (117), Expect = 4.377e-61
Identity = 33/80 (41.25%), Postives = 42/80 (52.50%), Query Frame = 3
Query:  435 PGRFDRQVTVDVPDIRGKNRDIKRFTGSNKKFDANGVSLMGKPEQTPGFQAADFATLKEQAGIFACDDGRQVA--IVFEK 668
            PGRFDRQV V +PD+RG+ + +K      K   +  V  M     TPGF  AD A L  +A +FA     +V   I FEK
Sbjct:  310 PGRFDRQVIVALPDVRGRKQILK--VHMRKVPLSEDVDPMIIARGTPGFSGADLANLVNEAALFAARFNNRVVSMIHFEK 387          
BLAST of EY665459 vs. ExPASy Swiss-Prot
Match: FTSH1_HAEIN (Cell division protease ftsH homolog 1 OS=Haemophilus influenzae GN=ftsH-A PE=3 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 5.706e-61
Identity = 99/146 (67.81%), Postives = 119/146 (81.51%), Query Frame = 2
Query:    8 VRFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVXXXXXXXXXXXNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRAWTF 445
            V FL+ P +F  +G +IPKG+L+VGPPGTGKTLLA+AIAGEA VPFF+ISGS+FVEMFVGVGASRVRD+F++AK+NAPC++F+DEIDAV           +DEREQTLNQ+L EMDGF GN G+IVIAATNR D+LD AL R   F
Sbjct:  167 VDFLRDPNKFQNLGGKIPKGILMVGPPGTGKTLLARAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFEQAKKNAPCLIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFSGNDGVIVIAATNRPDVLDPALTRPGRF 312          

HSP 2 Score: 51.9878 bits (123), Expect = 5.706e-61
Identity = 28/77 (36.36%), Postives = 40/77 (51.95%), Query Frame = 3
Query:  435 PGRFDRQVTVDVPDIRGKNRDIKRFTGSNKKFDANGVSLMGKPEQTPGFQAADFATLKEQAGIFACDDGRQVAIVFE 665
            PGRFDRQV V +PD++G+ + +K      K   A  V  M     TPG+  AD A L  +A +FA    ++   + E
Sbjct:  309 PGRFDRQVVVGLPDVKGREQILK--VHMRKVSVAQDVDAMTLARGTPGYSGADLANLVNEAALFAARVNKRTVTMLE 383          
BLAST of EY665459 vs. ExPASy Swiss-Prot
Match: FTSH_BUCAI (Cell division protease ftsH OS=Buchnera aphidicola subsp. Acyrthosiphon pisum GN=ftsH PE=3 SV=2)

HSP 1 Score: 206.453 bits (524), Expect = 5.707e-61
Identity = 100/146 (68.49%), Postives = 121/146 (82.88%), Query Frame = 2
Query:    8 VRFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVXXXXXXXXXXXNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRAWTF 445
            V +LK+P RF  +G +IPKG+L+VGPPGTGKTLLAKAIAGEA VPFF+ISGS+FVEMFVGVGASRVRD+F+ ++++APCI+F+DEIDAV           +DEREQTLNQ+L EMDGF+GN GII+IAATNR D+LD ALLR   F
Sbjct:  168 VEYLKEPSRFQKLGGKIPKGILMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFEHSRKSAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFDGNEGIILIAATNRPDVLDPALLRPGRF 313          

HSP 2 Score: 50.0618 bits (118), Expect = 5.707e-61
Identity = 31/77 (40.26%), Postives = 41/77 (53.25%), Query Frame = 3
Query:  435 PGRFDRQVTVDVPDIRGKNRDIKRFTGSNKKFDANGVSLMGKPEQTPGFQAADFATLKEQAGIFACDDGRQVAIVFE 665
            PGRFDRQV V +PDIRG+ + +K      K   +  V  M     TPGF  AD A L  +A +FA    ++V  + E
Sbjct:  310 PGRFDRQVIVALPDIRGREQILK--VHMRKVPLSKDVDPMIIARGTPGFSGADLANLVNEAALFAARLDKRVVSMLE 384          
BLAST of EY665459 vs. ExPASy Swiss-Prot
Match: FTSH_RICTY (Cell division protease ftsH homolog OS=Rickettsia typhi GN=ftsH PE=3 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 3.052e-59
Identity = 101/146 (69.18%), Postives = 117/146 (80.14%), Query Frame = 2
Query:    8 VRFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVXXXXXXXXXXXNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRAWTF 445
            V FL+ P +F  +G +IPKG LL+GPPGTGKTLLAKAIAGEA VPFFSISGS+FVEMFVGVGASRVRD+F++ K NAPCI+F+DEIDAV           NDEREQTLNQ+L EMDGFE N G+++IAATNR D+LD ALLR   F
Sbjct:  171 VDFLRDPSKFQKLGGKIPKGCLLIGPPGTGKTLLAKAIAGEANVPFFSISGSDFVEMFVGVGASRVRDMFEQGKRNAPCIIFIDEIDAVGRHRGIGMGGGNDEREQTLNQMLVEMDGFEANEGVVIIAATNRPDVLDRALLRPGRF 316          

HSP 2 Score: 42.3578 bits (98), Expect = 3.052e-59
Identity = 27/72 (37.50%), Postives = 36/72 (50.00%), Query Frame = 3
Query:  435 PGRFDRQVTVDVPDIRGKNRDIKRFTGSNKKFDANGVSLMG-KPEQTPGFQAADFATLKEQAGIFACDDGRQ 647
            PGRFDRQ+ V  PDI G+ + +K      KK   N   L       TPGF  A+ A L  +A + A   G++
Sbjct:  313 PGRFDRQIAVANPDINGREQILKVHL---KKIKYNSTVLARIIARGTPGFSGAELANLVNEAALIAARLGKK 381          
BLAST of EY665459 vs. ExPASy Swiss-Prot
Match: FTSH_RICPR (Cell division protease ftsH homolog OS=Rickettsia prowazekii GN=ftsH PE=3 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 3.052e-59
Identity = 101/146 (69.18%), Postives = 117/146 (80.14%), Query Frame = 2
Query:    8 VRFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVXXXXXXXXXXXNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRAWTF 445
            V FL+ P +F  +G +IPKG LL+GPPGTGKTLLAKAIAGEA VPFFSISGS+FVEMFVGVGASRVRD+F++ K NAPCI+F+DEIDAV           NDEREQTLNQ+L EMDGFE N G+++IAATNR D+LD ALLR   F
Sbjct:  171 VDFLRDPSKFQKLGGKIPKGCLLIGPPGTGKTLLAKAIAGEANVPFFSISGSDFVEMFVGVGASRVRDMFEQGKRNAPCIIFIDEIDAVGRHRGIGMGGGNDEREQTLNQMLVEMDGFEANEGVVIIAATNRPDVLDRALLRPGRF 316          

HSP 2 Score: 42.3578 bits (98), Expect = 3.052e-59
Identity = 27/72 (37.50%), Postives = 36/72 (50.00%), Query Frame = 3
Query:  435 PGRFDRQVTVDVPDIRGKNRDIKRFTGSNKKFDANGVSLMG-KPEQTPGFQAADFATLKEQAGIFACDDGRQ 647
            PGRFDRQ+ V  PDI G+ + +K      KK   N   L       TPGF  A+ A L  +A + A   G++
Sbjct:  313 PGRFDRQIAVANPDINGREQILKVHL---KKIKYNSTVLARIIARGTPGFSGAELANLVNEAALIAARLGKK 381          
BLAST of EY665459 vs. ExPASy Swiss-Prot
Match: FTSH_RICFE (Cell division protease ftsH homolog OS=Rickettsia felis GN=ftsH PE=3 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 3.052e-59
Identity = 101/146 (69.18%), Postives = 117/146 (80.14%), Query Frame = 2
Query:    8 VRFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVXXXXXXXXXXXNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRAWTF 445
            V FL+ P +F  +G +IPKG LL+GPPGTGKTLLAKAIAGEA VPFFSISGS+FVEMFVGVGASRVRD+F++ K NAPCI+F+DEIDAV           NDEREQTLNQ+L EMDGFE N G+++IAATNR D+LD ALLR   F
Sbjct:  171 VDFLRDPSKFQKLGGKIPKGCLLIGPPGTGKTLLAKAIAGEANVPFFSISGSDFVEMFVGVGASRVRDMFEQGKRNAPCIIFIDEIDAVGRHRGIGMGGGNDEREQTLNQMLVEMDGFEANEGVVIIAATNRPDVLDRALLRPGRF 316          

HSP 2 Score: 42.3578 bits (98), Expect = 3.052e-59
Identity = 27/72 (37.50%), Postives = 36/72 (50.00%), Query Frame = 3
Query:  435 PGRFDRQVTVDVPDIRGKNRDIKRFTGSNKKFDANGVSLMG-KPEQTPGFQAADFATLKEQAGIFACDDGRQ 647
            PGRFDRQ+ V  PDI G+ + +K      KK   N   L       TPGF  A+ A L  +A + A   G++
Sbjct:  313 PGRFDRQIAVANPDINGREQILKVHL---KKIKYNSTVLARIIARGTPGFSGAELANLVNEAALIAARLGKK 381          
BLAST of EY665459 vs. ExPASy Swiss-Prot
Match: FTSH_RICCN (Cell division protease ftsH homolog OS=Rickettsia conorii GN=ftsH PE=3 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 3.052e-59
Identity = 101/146 (69.18%), Postives = 117/146 (80.14%), Query Frame = 2
Query:    8 VRFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVXXXXXXXXXXXNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRAWTF 445
            V FL+ P +F  +G +IPKG LL+GPPGTGKTLLAKAIAGEA VPFFSISGS+FVEMFVGVGASRVRD+F++ K NAPCI+F+DEIDAV           NDEREQTLNQ+L EMDGFE N G+++IAATNR D+LD ALLR   F
Sbjct:  171 VDFLRDPSKFQKLGGKIPKGCLLIGPPGTGKTLLAKAIAGEANVPFFSISGSDFVEMFVGVGASRVRDMFEQGKRNAPCIIFIDEIDAVGRHRGIGMGGGNDEREQTLNQMLVEMDGFEANEGVVIIAATNRPDVLDRALLRPGRF 316          

HSP 2 Score: 42.3578 bits (98), Expect = 3.052e-59
Identity = 27/72 (37.50%), Postives = 36/72 (50.00%), Query Frame = 3
Query:  435 PGRFDRQVTVDVPDIRGKNRDIKRFTGSNKKFDANGVSLMG-KPEQTPGFQAADFATLKEQAGIFACDDGRQ 647
            PGRFDRQ+ V  PDI G+ + +K      KK   N   L       TPGF  A+ A L  +A + A   G++
Sbjct:  313 PGRFDRQIAVANPDINGREQILKVHL---KKIKYNSTVLARIIARGTPGFSGAELANLVNEAALIAARLGKK 381          
BLAST of EY665459 vs. ExPASy Swiss-Prot
Match: FTSH_RICBR (Cell division protease ftsH homolog OS=Rickettsia bellii (strain RML369-C) GN=ftsH PE=3 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 8.818e-59
Identity = 101/146 (69.18%), Postives = 118/146 (80.82%), Query Frame = 2
Query:    8 VRFLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVXXXXXXXXXXXNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRAWTF 445
            V FL+ P +F  +G +IPKG LL+GPPGTGKTLLAKAIAGEA VPFFSISGS+FVEMFVGVGASRVRD+F++ K NAPCI+F+DEIDAV           NDEREQTLNQ+L EMDGFE N G+++IAATNR D+LD+ALLR   F
Sbjct:  171 VDFLRDPSKFQKLGGKIPKGCLLIGPPGTGKTLLAKAIAGEANVPFFSISGSDFVEMFVGVGASRVRDMFEQGKRNAPCIIFIDEIDAVGRHRGIGMGGGNDEREQTLNQMLVEMDGFEANEGVVIIAATNRPDVLDNALLRPGRF 316          

HSP 2 Score: 40.0466 bits (92), Expect = 8.818e-59
Identity = 27/72 (37.50%), Postives = 36/72 (50.00%), Query Frame = 3
Query:  435 PGRFDRQVTVDVPDIRGKNR----DIKRFTGSNK---KFDANGVSLMGKPEQTPGFQAADFATLKEQAGIFA 629
            PGRFDRQ+TV  PDI G+ +     +K+   S K   +  A G         TPGF  A+ A L  +A + A
Sbjct:  313 PGRFDRQITVSNPDIDGREKILQVHLKKVKYSTKIVPRIIARG---------TPGFSGAELANLVNEATLIA 375          
BLAST of EY665459 vs. ExPASy Swiss-Prot
Match: FTSH_MYCTU (Cell division protease ftsH homolog OS=Mycobacterium tuberculosis GN=ftsH PE=3 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 7.351e-58
Identity = 103/144 (71.53%), Postives = 119/144 (82.64%), Query Frame = 2
Query:   14 FLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVXXXXXXXXXXXNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRAWTF 445
            FL+ P R+ A+GA+IPKGVLL GPPGTGKTLLA+A+AGEAGVPFF+ISGS+FVEMFVGVGASRVRDLF++AK+N+PCI+FVDEIDAV           +DEREQTLNQLL EMDGF    G+I+IAATNR DILD ALLR   F
Sbjct:  181 FLQNPSRYQALGAKIPKGVLLYGPPGTGKTLLARAVAGEAGVPFFTISGSDFVEMFVGVGASRVRDLFEQAKQNSPCIIFVDEIDAVGRQRGAGLGGGHDEREQTLNQLLVEMDGFGDRAGVILIAATNRPDILDPALLRPGRF 324          

HSP 2 Score: 38.891 bits (89), Expect = 7.351e-58
Identity = 24/72 (33.33%), Postives = 35/72 (48.61%), Query Frame = 3
Query:  435 PGRFDRQVTVDVPDIRGKNRDIKRFTGSNKKFDANGVSLMGKPEQTPGFQAADFATLKEQAGIFACDDGRQV 650
            PGRFDRQ+ V  PD+ G+ R + R     K   A+   L G  ++T G   AD A +  +A +    +   V
Sbjct:  321 PGRFDRQIPVSNPDLAGR-RAVLRVHSKGKPMAAD-ADLDGLAKRTVGMTGADLANVINEAALLTARENGTV 390          
BLAST of EY665459 vs. ExPASy Swiss-Prot
Match: FTSH_MYCTA (Cell division protease ftsH homolog OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=ftsH PE=3 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 7.351e-58
Identity = 103/144 (71.53%), Postives = 119/144 (82.64%), Query Frame = 2
Query:   14 FLKKPERFTAVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGSEFVEMFVGVGASRVRDLFKKAKENAPCIVFVDEIDAVXXXXXXXXXXXNDEREQTLNQLLTEMDGFEGNTGIIVIAATNRADILDSALLRAWTF 445
            FL+ P R+ A+GA+IPKGVLL GPPGTGKTLLA+A+AGEAGVPFF+ISGS+FVEMFVGVGASRVRDLF++AK+N+PCI+FVDEIDAV           +DEREQTLNQLL EMDGF    G+I+IAATNR DILD ALLR   F
Sbjct:  181 FLQNPSRYQALGAKIPKGVLLYGPPGTGKTLLARAVAGEAGVPFFTISGSDFVEMFVGVGASRVRDLFEQAKQNSPCIIFVDEIDAVGRQRGAGLGGGHDEREQTLNQLLVEMDGFGDRAGVILIAATNRPDILDPALLRPGRF 324          

HSP 2 Score: 38.891 bits (89), Expect = 7.351e-58
Identity = 24/72 (33.33%), Postives = 35/72 (48.61%), Query Frame = 3
Query:  435 PGRFDRQVTVDVPDIRGKNRDIKRFTGSNKKFDANGVSLMGKPEQTPGFQAADFATLKEQAGIFACDDGRQV 650
            PGRFDRQ+ V  PD+ G+ R + R     K   A+   L G  ++T G   AD A +  +A +    +   V
Sbjct:  321 PGRFDRQIPVSNPDLAGR-RAVLRVHSKGKPMAAD-ADLDGLAKRTVGMTGADLANVINEAALLTARENGTV 390          
The following BLAST results are available for this feature:
BLAST of EY665459 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 380
Match NameE-valueIdentityDescription
FTSH_BUCAP4.377e-6168.49Cell division protease ftsH OS=Buchnera aphidicola... [more]
FTSH1_HAEIN5.706e-6167.81Cell division protease ftsH homolog 1 OS=Haemophil... [more]
FTSH_BUCAI5.707e-6168.49Cell division protease ftsH OS=Buchnera aphidicola... [more]
FTSH_RICTY3.052e-5969.18Cell division protease ftsH homolog OS=Rickettsia ... [more]
FTSH_RICPR3.052e-5969.18Cell division protease ftsH homolog OS=Rickettsia ... [more]
FTSH_RICFE3.052e-5969.18Cell division protease ftsH homolog OS=Rickettsia ... [more]
FTSH_RICCN3.052e-5969.18Cell division protease ftsH homolog OS=Rickettsia ... [more]
FTSH_RICBR8.818e-5969.18Cell division protease ftsH homolog OS=Rickettsia ... [more]
FTSH_MYCTU7.351e-5871.53Cell division protease ftsH homolog OS=Mycobacteri... [more]
FTSH_MYCTA7.351e-5871.53Cell division protease ftsH homolog OS=Mycobacteri... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-102-002-D01-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 2 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665459 ID=EY665459|Name=EY665459|organism=Citrus sinensis|type=EST|length=834bp
CCCACGCGTCCGGTTCCTTAAGAAGCCTGAGAGATTTACAGCTGTTGGAG
CTCGTATTCCAAAGGGTGTTCTTCTCGTTGGTCCTCCAGGAACTGGGAAG
ACTCTTCTTGCCAAGGCAATTGCTGGTGAAGCCGGTGTTCCATTTTTCTC
CATATCAGGTTCTGAGTTTGTTGAGATGTTTGTTGGTGTCGGTGCATCTA
GAGTCCGAGATCTTTTCAAGAAGGCCAAAGAGAATGCTCCTTGCATTGTA
TTTGTGGATGAAATTGATGCCGTTGGAAGACAAAGAGGAACTGGAATTGG
AGGAGGGAATGATGAAAGAGAGCAGACCCTTAACCAGCTTTTGACAGAAA
TGGATGGTTTTGAGGGTAATACTGGTATCATTGTGATTGCTGCAACTAAC
AGGGCGGACATTCTTGATTCTGCCTTATTGAGGGCCTGGACGTTTTGATA
GACAGGTTACTGTTGATGTTCCTGACATTCGAGGAAAGAACAGAGATATT
AAAAGGTTCACGGGTAGCAACAAAAAATTTGATGCAAATGGTGTCTCCTT
GATGGGAAAGCCAGAACAAACCCCTGGGTTCCAGGCTGCTGACTTTGCAA
CCCTCAAAGAACAGGCAGGCATCTTTGCGTGCGACGACGGGCGGCAAGTG
GCTATTGTATTTGAAAAAAAATGACCAATACAAGTGAAACGCAATGTTCA
TTCACACCCAACACAATCACCCTCACCAAACACGGGCAGAAACGACTGAT
AGTCGGAACGCACAAACACGCGCCCGAGAAAAAGCAAGCACCCGAAACCT
CGGAAACAATAATGCCATCATTACAACTCAGACC
back to top