EY665457

Overview
NameEY665457
Unique NameEY665457
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length916
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALX_ASPFU (Calnexin homolog OS=Aspergillus fumigatus GN=AFUA_4G12850 PE=2 SV=2)

HSP 1 Score: 167.548 bits (423), Expect = 9.327e-41
Identity = 78/137 (56.93%), Postives = 87/137 (63.50%), Query Frame = 2
Query:  134 AKIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKP-DFEPIAAVGIEIW 541
            AKIPDP+A KP+DWDEDAP EI DE+A  PE WL           A KP             P + NPKC    GCG W  PMK+NPAYKGKW AP IDNP YKGIWKP++IPNP YFE   P +FEP+ AVG EIW
Sbjct:  268 AKIPDPEAKKPDDWDEDAPYEIVDEEATMPEDWLEDEPTSIPDPEAEKPEDWDDEEDGDWIPPTVPNPKCNEVSGCGPWTPPMKKNPAYKGKWTAPLIDNPAYKGIWKPRKIPNPAYFEDKTPSNFEPMGAVGFEIW 404          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CLGN_MOUSE (Calmegin OS=Mus musculus GN=Clgn PE=2 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 7.390e-38
Identity = 76/157 (48.41%), Postives = 96/157 (61.15%), Query Frame = 2
Query:  131 RAKIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKPD-FEPIAAVGIEIWDNAGWVFLFETFLISKDEK 598
            RAKIPDP AVKPEDWDE+ P +IED  AVKP+GWL           A KP            AP I NP C+   GCGEWK PM  NP YKG W  P I+NPNY+G+W PQ+IPNP+YFE D P      +A+G+E+W     ++ F+ F+I  +++
Sbjct:  281 RAKIPDPTAVKPEDWDENEPAQIEDSSAVKPDGWLDDEPKFIPNPKAEKPEDWSDDMDGEWEAPHIPNPACQI--GCGEWKPPMIDNPKYKGIWRPPMINNPNYQGLWSPQKIPNPDYFEDDHPFLLTSFSALGLELWSMTPDIY-FDNFIICSEKE 434          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CLGN_HUMAN (Calmegin OS=Homo sapiens GN=CLGN PE=1 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 3.668e-37
Identity = 75/157 (47.77%), Postives = 93/157 (59.24%), Query Frame = 2
Query:  131 RAKIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKPD-FEPIAAVGIEIWDNAGWVFLFETFLISKDEK 598
            RAKIPDP AVKPEDWDE  P +IED   VKP GWL           A KP            AP+I NP C    GCGEWK PM  NP YKG W  P +DNPNY+GIW P++IPNP+YFE D P      +A+G+E+W     ++ F+ F+I  +++
Sbjct:  281 RAKIPDPSAVKPEDWDESEPAQIEDSSVVKPAGWLDDEPKFIPDPNAEKPDDWNEDTDGEWEAPQILNPACRI--GCGEWKPPMIDNPKYKGVWRPPLVDNPNYQGIWSPRKIPNPDYFEDDHPFLLTSFSALGLELWSMTSDIY-FDNFIICSEKE 434          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CLGN_BOVIN (Calmegin OS=Bos taurus GN=CLGN PE=2 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 4.483e-35
Identity = 73/157 (46.50%), Postives = 90/157 (57.32%), Query Frame = 2
Query:  131 RAKIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKPD-FEPIAAVGIEIWDNAGWVFLFETFLISKDEK 598
            RAKIPD  AVKPEDWDE  P +I D  AVKP+GWL           A KP            AP I NP C    GCGEW  PM  NP YKG W  P IDNPNY+GIW P++IPNP+YFE + P       A+G+E+W     ++ F+ F+I  +++
Sbjct:  277 RAKIPDASAVKPEDWDESEPPQIVDSSAVKPDGWLDNEPEFIPDPNAEKPFDWNEDMDGEWEAPHISNPACRI--GCGEWSPPMIDNPKYKGIWRPPMIDNPNYQGIWSPRKIPNPDYFEDNHPFLLTSFRALGLELWSMTSDIY-FDNFIICSEKE 430          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALX_SCHPO (Calnexin homolog OS=Schizosaccharomyces pombe GN=cal1 PE=1 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 1.104e-33
Identity = 68/136 (50.00%), Postives = 80/136 (58.82%), Query Frame = 2
Query:  137 KIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKPD-FEPIAAVGIEIW 541
            +IPDP+AVKP+DWDEDAP  I D DAVKPE WL           A KP              +I NPKC    GCGEWK PM RNP Y+G W  P I NP + G W P++IPNP+YF+ D P  F P+  VG E+W
Sbjct:  258 EIPDPNAVKPDDWDEDAPRMIPDPDAVKPEDWLEDEPLYIPDPEAQKPEDWDDEEDGDWIPSEIINPKCIEGAGCGEWKPPMIRNPNYRGPWSPPMIPNPEFIGEWYPRKIPNPDYFDDDHPSHFGPLYGVGFELW 393          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALX_CAEEL (Calnexin homolog OS=Caenorhabditis elegans GN=cnx-1 PE=1 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 2.546e-30
Identity = 70/158 (44.30%), Postives = 83/158 (52.53%), Query Frame = 2
Query:  131 RAKIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKP--DFEPIAAVGIEIWDNAGWVFLFETFLISKDEK 598
            R  I D  AVKP+DWDE+ P  + DE A KP  W            A KP            AP IDNP C+   GCG WK P  +NP YKGKW  P I NP +KG W  + I NPNYFE  KP     PI AVGIE+W  +  + LF+  LI+  E+
Sbjct:  282 RENIEDESAVKPDDWDENEPQSVVDEAATKPYDWNEEENELIADPEAKKPQDWDEDMDGSWEAPLIDNPACKGLSGCGTWKAPTIKNPKYKGKWIRPKISNPAFKGKWTARLIDNPNYFE-PKPFAGLAPITAVGIEMWTMSENI-LFDNILITSSEE 437          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALR_RAT (Calreticulin OS=Rattus norvegicus GN=Calr PE=1 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 6.504e-18
Identity = 57/158 (36.08%), Postives = 75/158 (47.47%), Query Frame = 2
Query:  137 KIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKPD-----FEPIAAVGIEIWDNAGWVFLFETFLISKDE 595
            KI DPDA KPEDWDE A  +I+D    KPE W              KP             P    P+       GEW+ P+ +NP YKG+W    IDNP+YKG W   +I NP Y     PD     ++  A +G+++W       +F+ FLI+ DE
Sbjct:  207 KIKDPDAAKPEDWDERA--KIDDPTDSKPEDW-------------DKPEHIPD--------PDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEY----SPDANIYAYDSFAVLGLDLWQVKSGT-IFDNFLITNDE 336          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALR_MOUSE (Calreticulin OS=Mus musculus GN=Calr PE=1 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 6.504e-18
Identity = 57/158 (36.08%), Postives = 75/158 (47.47%), Query Frame = 2
Query:  137 KIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKPD-----FEPIAAVGIEIWDNAGWVFLFETFLISKDE 595
            KI DPDA KPEDWDE A  +I+D    KPE W              KP             P    P+       GEW+ P+ +NP YKG+W    IDNP+YKG W   +I NP Y     PD     ++  A +G+++W       +F+ FLI+ DE
Sbjct:  207 KIKDPDAAKPEDWDERA--KIDDPTDSKPEDW-------------DKPEHIPD--------PDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEY----SPDANIYAYDSFAVLGLDLWQVKSGT-IFDNFLITNDE 336          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALR_CRIGR (Calreticulin OS=Cricetulus griseus GN=CALR PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 6.504e-18
Identity = 57/158 (36.08%), Postives = 75/158 (47.47%), Query Frame = 2
Query:  137 KIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKPD-----FEPIAAVGIEIWDNAGWVFLFETFLISKDE 595
            KI DPDA KPEDWDE A  +I+D    KPE W              KP             P    P+       GEW+ P+ +NP YKG+W    IDNP+YKG W   +I NP Y     PD     ++  A +G+++W       +F+ FLI+ DE
Sbjct:  207 KIKDPDAAKPEDWDERA--KIDDPTDSKPEDW-------------DKPEHIPD--------PDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEY----SPDANIYAYDSFAVLGLDLWQVKSGT-IFDNFLITNDE 336          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALR_RABIT (Calreticulin OS=Oryctolagus cuniculus GN=CALR PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.109e-17
Identity = 57/158 (36.08%), Postives = 75/158 (47.47%), Query Frame = 2
Query:  137 KIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKPD-----FEPIAAVGIEIWDNAGWVFLFETFLISKDE 595
            KI DPDA KPEDWDE A  +I+D    KPE W              KP             P    P+       GEW+ P+ +NP YKG+W    IDNP+YKG W   +I NP Y     PD     ++  A +G+++W       +F+ FLI+ DE
Sbjct:  207 KIKDPDASKPEDWDERA--KIDDPTDSKPEDW-------------DKPEHIPD--------PDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEY----SPDANIYAYDSFAVLGLDLWQVKSGT-IFDNFLITNDE 336          
The following BLAST results are available for this feature:
BLAST of EY665457 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 37
Match NameE-valueIdentityDescription
CALX_ASPFU9.327e-4156.93Calnexin homolog OS=Aspergillus fumigatus GN=AFUA_... [more]
CLGN_MOUSE7.390e-3848.41Calmegin OS=Mus musculus GN=Clgn PE=2 SV=1[more]
CLGN_HUMAN3.668e-3747.77Calmegin OS=Homo sapiens GN=CLGN PE=1 SV=1[more]
CLGN_BOVIN4.483e-3546.50Calmegin OS=Bos taurus GN=CLGN PE=2 SV=1[more]
CALX_SCHPO1.104e-3350.00Calnexin homolog OS=Schizosaccharomyces pombe GN=c... [more]
CALX_CAEEL2.546e-3044.30Calnexin homolog OS=Caenorhabditis elegans GN=cnx-... [more]
CALR_RAT6.504e-1836.08Calreticulin OS=Rattus norvegicus GN=Calr PE=1 SV=... [more]
CALR_MOUSE6.504e-1836.08Calreticulin OS=Mus musculus GN=Calr PE=1 SV=1[more]
CALR_CRIGR6.504e-1836.08Calreticulin OS=Cricetulus griseus GN=CALR PE=2 SV... [more]
CALR_RABIT1.109e-1736.08Calreticulin OS=Oryctolagus cuniculus GN=CALR PE=1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-102-002-C09-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 2 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665457 ID=EY665457|Name=EY665457|organism=Citrus sinensis|type=EST|length=916bp
GTGACTGCGGTACGGTCGGGATTCCCGGGTCGACCCCGCGTCCGCGCTGC
TGATGATTTTCAGCCTCTTTCTCATTCCTGAGAAGACAATTCCTGATCCA
GATGACAAGAAGCCTGAGGATTGGGATGAGAGGGCAAAGATTCCTGACCC
TGATGCAGTAAAACCTGAAGACTGGGATGAGGATGCTCCCATGGAAATTG
AAGATGAGGATGCTGTGAAACCTGAAGGATGGCTGGATGATGACCCTGAG
GAGATAGATGACCCTGAGGCCACAAAACCTGAGGATTGGGATGATGAGGA
GGATGGTGAATGGGAGGCCCCAAAGATTGATAACCCAAAGTGTGAAGCAG
CCCCTGGATGCGGCGAGTGGAAGAGGCCAATGAAGAGGAATCCTGCCTAC
AAGGGCAAATGGCATGCTCCACATATTGACAACCCTAATTACAAGGGTAT
TTGGAAGCCTCAGCAGATTCCAAACCCCAACTATTTTGAGCTTGACAAAC
CTGACTTTGAGCCTATTGCTGCTGTTGGCATTGAGATCTGGGACAATGCA
GGATGGGTATTTTTGTTTGAAACATTTTTGATATCAAAGGATGAGAAAAG
TTGCCAAGTCCTATCGGGCCTCCTGCATGGAAGCCTAAAGTTTGGATGTT
GAAAAAGAAAACTTGAAGGTGAGGAAGCAGCTGCTTGGTTCAAAGGGCTT
TGCAGGCTTCCCGAAAAAAGGAATTGATTCTCTTGAACAAGGGTTGCAAA
AATTCCTTTCTTGGATGCATACCAACTTAAAAAATCTTGAATGGGATTGA
AAAAGGGAAAAAAAAAACCCAACCCTTAAAATTTGGGTTTTCCTTGCTTT
CTGTTTGGGGGGGGGAATTTTTCCCATTTCTTTTTCCAAAATACTTATTT
GTGGGGGGAAAAGAAA
back to top