EY665457

Overview
NameEY665457
Unique NameEY665457
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length916
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALR_EUGGR (Calreticulin OS=Euglena gracilis PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.109e-17
Identity = 51/141 (36.17%), Postives = 67/141 (47.52%), Query Frame = 2
Query:  146 DPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKPD-FEPIAAVGIEIWD-NAGWVF 562
            DP+  KPEDWD++ P +I D DA +P+ W                                           G+W+ PM  NP YKG+W A  I NP YKG+WKP+ IPNP Y   DK   F+ IAAVG ++W   +G +F
Sbjct:  223 DPEDKKPEDWDKE-PAQIPDPDATQPDDWDEEED--------------------------------------GKWEAPMISNPKYKGEWKAKKIPNPAYKGVWKPRDIPNPEYEADDKVHIFDEIAAVGFDLWQVKSGTIF 324          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALR_MACFU (Calreticulin OS=Macaca fuscata fuscata GN=CALR PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 4.216e-17
Identity = 56/158 (35.44%), Postives = 74/158 (46.84%), Query Frame = 2
Query:  137 KIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKPD-----FEPIAAVGIEIWDNAGWVFLFETFLISKDE 595
            KI DPDA KPEDWDE A  +I+D    KPE W              KP             P    P+       GEW+ P+ +NP YKG+W    IDNP+YKG W   +I NP Y     PD     ++    +G+++W       +F+ FLI+ DE
Sbjct:  207 KIKDPDASKPEDWDERA--KIDDPTDSKPEDW-------------DKPEHIPD--------PDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEY----SPDPSIYAYDNFGVLGLDLWQVKSGT-IFDNFLITNDE 336          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALR_MACFA (Calreticulin OS=Macaca fascicularis GN=CALR PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 4.216e-17
Identity = 56/158 (35.44%), Postives = 74/158 (46.84%), Query Frame = 2
Query:  137 KIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKPD-----FEPIAAVGIEIWDNAGWVFLFETFLISKDE 595
            KI DPDA KPEDWDE A  +I+D    KPE W              KP             P    P+       GEW+ P+ +NP YKG+W    IDNP+YKG W   +I NP Y     PD     ++    +G+++W       +F+ FLI+ DE
Sbjct:  207 KIKDPDASKPEDWDERA--KIDDPTDSKPEDW-------------DKPEHIPD--------PDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEY----SPDPSIYAYDNFGVLGLDLWQVKSGT-IFDNFLITNDE 336          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALR_HUMAN (Calreticulin OS=Homo sapiens GN=CALR PE=1 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 4.216e-17
Identity = 56/158 (35.44%), Postives = 74/158 (46.84%), Query Frame = 2
Query:  137 KIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKPD-----FEPIAAVGIEIWDNAGWVFLFETFLISKDE 595
            KI DPDA KPEDWDE A  +I+D    KPE W              KP             P    P+       GEW+ P+ +NP YKG+W    IDNP+YKG W   +I NP Y     PD     ++    +G+++W       +F+ FLI+ DE
Sbjct:  207 KIKDPDASKPEDWDERA--KIDDPTDSKPEDW-------------DKPEHIPD--------PDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEY----SPDPSIYAYDNFGVLGLDLWQVKSGT-IFDNFLITNDE 336          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALR_CERAE (Calreticulin OS=Cercopithecus aethiops GN=CALR PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 4.216e-17
Identity = 56/158 (35.44%), Postives = 74/158 (46.84%), Query Frame = 2
Query:  137 KIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKPD-----FEPIAAVGIEIWDNAGWVFLFETFLISKDE 595
            KI DPDA KPEDWDE A  +I+D    KPE W              KP             P    P+       GEW+ P+ +NP YKG+W    IDNP+YKG W   +I NP Y     PD     ++    +G+++W       +F+ FLI+ DE
Sbjct:  207 KIKDPDASKPEDWDERA--KIDDPTDSKPEDW-------------DKPEHIPD--------PDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEY----SPDPSIYAYDNFGVLGLDLWQVKSGT-IFDNFLITNDE 336          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALR_DROME (Calreticulin OS=Drosophila melanogaster GN=Crc PE=1 SV=2)

HSP 1 Score: 88.1965 bits (217), Expect = 7.191e-17
Identity = 54/155 (34.84%), Postives = 70/155 (45.16%), Query Frame = 2
Query:  131 RAKIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKPDF-EPIAAVGIEIWDNAGWVFLFETFLISKD 592
            RA IPDPD  KPEDWD+  P  I D DA KPE W                              ++D          GEW+ PM  NP +KG+W    +DNPNYKG W+  +I NP Y   DK    + I  +G ++W       +F+  LI+ D
Sbjct:  222 RATIPDPDDKKPEDWDK--PEHIPDPDATKPEDW----------------------------DDEMD----------GEWEPPMIDNPEFKGEWQPKQLDNPNYKGAWEHPEIANPEYVPDDKLYLRKEICTLGFDLWQVKSGT-IFDNVLITDD 335          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALX_YEAST (Calnexin homolog OS=Saccharomyces cerevisiae GN=CNE1 PE=1 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.569e-16
Identity = 53/163 (32.52%), Postives = 68/163 (41.72%), Query Frame = 2
Query:  131 RAKIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKP--DFEPIAAVGIEIWDNAGWVFLFETFLISKDEKSCQVL 613
            R +IPDP+AVK  D DE  P+ I   D  +P  W            A KP             P I NP C A  GCG+    +  N  YKG      I NPNY G W P +I NP Y+E   P      I+ V +E W  +    L     + K+    Q++
Sbjct:  262 RIRIPDPEAVKLSDRDERDPLMIPHPDGTEPPEWNSSIPEYILDPNAQKPSWWKELEHGEWIPPMIKNPLCTAERGCGQQIPGLINNAKYKGPGELNEIINPNYMGEWHPPEIENPLYYEEQHPLRIENVISGVILEFWSGSP-NMLISNIYVGKNVTEAQII 423          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALR_ONCVO (Calreticulin OS=Onchocerca volvulus GN=crt-1 PE=2 SV=2)

HSP 1 Score: 85.1149 bits (209), Expect = 6.088e-16
Identity = 53/143 (37.06%), Postives = 69/143 (48.25%), Query Frame = 2
Query:  137 KIPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKPDFEPIAAVGIEIWD-NAGWVF 562
            KI DPDA KPEDWDE     I+DED  KPE W            A KP             P +DNP+ +     GEWK   K+NPAYKGKW  P I+ P+Y         P+ N +      ++ I A+G ++W   +G +F
Sbjct:  205 KIKDPDAKKPEDWDERE--FIDDEDDKKPEDW--DKPEHIPDPDAKKPEDWDDEMDGEWEPPMVDNPEYK-----GEWKPKQKKNPAYKGKWIHPEIEIPDY--------TPDDNLYV-----YDDIGAIGFDLWQVKSGTIF 325          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALR_BOVIN (Calreticulin OS=Bos taurus GN=CALR PE=1 SV=2)

HSP 1 Score: 83.9593 bits (206), Expect = 1.356e-15
Identity = 50/148 (33.78%), Postives = 67/148 (45.27%), Query Frame = 2
Query:  167 EDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDKPD-----FEPIAAVGIEIWDNAGWVFLFETFLISKDE 595
            +DWD   P +I+D DA KPE W             T               P    P+       GEW+ P+ +NP YKG+W    IDNP YKGIW   +I NP Y     PD     +E  A +G+++W       +F+ FLI+ DE
Sbjct:  198 DDWDFLPPKKIKDPDAAKPEDW----DDRAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPEYKGIWIHPEIDNPEY----SPDSNIYAYENFAVLGLDLWQVKSGT-IFDNFLITNDE 336          
BLAST of EY665457 vs. ExPASy Swiss-Prot
Match: CALR_CHLRE (Calreticulin OS=Chlamydomonas reinhardtii PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.313e-15
Identity = 56/153 (36.60%), Postives = 69/153 (45.10%), Query Frame = 2
Query:  140 IPDPDAVKPEDWDEDAPMEIEDEDAVKPEGWLXXXXXXXXXXXATKPXXXXXXXXXXXXAPKIDNPKCEAAPGCGEWKRPMKRNPAYKGKWHAPHIDNPNYKGIWKPQQIPNPNYFELDK-PDFEPIAAVGIEIWD-NAGWVFLFETFLISKD 592
            I DP A KPEDWDE    EI D +  KPEGW            A KP                           G W+ PM  NP YKG+W A  I NP YKGIW    I NP+Y   DK  +F+ +  VG E+W   +G   +F+  L++ D
Sbjct:  211 IKDPKASKPEDWDERE--EIADPEDKKPEGW-DDIPATIADKDAKKPEDWDDEED-------------------GTWEPPMIPNPEYKGEWKAKMIKNPAYKGIWVAPDIDNPDYVHDDKLYNFKDLKFVGFELWQVKSG--SIFDNILVTDD 339          
The following BLAST results are available for this feature:
BLAST of EY665457 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 37
Match NameE-valueIdentityDescription
CALR_EUGGR1.109e-1736.17Calreticulin OS=Euglena gracilis PE=2 SV=1[more]
CALR_MACFU4.216e-1735.44Calreticulin OS=Macaca fuscata fuscata GN=CALR PE=... [more]
CALR_MACFA4.216e-1735.44Calreticulin OS=Macaca fascicularis GN=CALR PE=2 S... [more]
CALR_HUMAN4.216e-1735.44Calreticulin OS=Homo sapiens GN=CALR PE=1 SV=1[more]
CALR_CERAE4.216e-1735.44Calreticulin OS=Cercopithecus aethiops GN=CALR PE=... [more]
CALR_DROME7.191e-1734.84Calreticulin OS=Drosophila melanogaster GN=Crc PE=... [more]
CALX_YEAST3.569e-1632.52Calnexin homolog OS=Saccharomyces cerevisiae GN=CN... [more]
CALR_ONCVO6.088e-1637.06Calreticulin OS=Onchocerca volvulus GN=crt-1 PE=2 ... [more]
CALR_BOVIN1.356e-1533.78Calreticulin OS=Bos taurus GN=CALR PE=1 SV=2[more]
CALR_CHLRE2.313e-1536.60Calreticulin OS=Chlamydomonas reinhardtii PE=2 SV=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-102-002-C09-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 2 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665457 ID=EY665457|Name=EY665457|organism=Citrus sinensis|type=EST|length=916bp
GTGACTGCGGTACGGTCGGGATTCCCGGGTCGACCCCGCGTCCGCGCTGC
TGATGATTTTCAGCCTCTTTCTCATTCCTGAGAAGACAATTCCTGATCCA
GATGACAAGAAGCCTGAGGATTGGGATGAGAGGGCAAAGATTCCTGACCC
TGATGCAGTAAAACCTGAAGACTGGGATGAGGATGCTCCCATGGAAATTG
AAGATGAGGATGCTGTGAAACCTGAAGGATGGCTGGATGATGACCCTGAG
GAGATAGATGACCCTGAGGCCACAAAACCTGAGGATTGGGATGATGAGGA
GGATGGTGAATGGGAGGCCCCAAAGATTGATAACCCAAAGTGTGAAGCAG
CCCCTGGATGCGGCGAGTGGAAGAGGCCAATGAAGAGGAATCCTGCCTAC
AAGGGCAAATGGCATGCTCCACATATTGACAACCCTAATTACAAGGGTAT
TTGGAAGCCTCAGCAGATTCCAAACCCCAACTATTTTGAGCTTGACAAAC
CTGACTTTGAGCCTATTGCTGCTGTTGGCATTGAGATCTGGGACAATGCA
GGATGGGTATTTTTGTTTGAAACATTTTTGATATCAAAGGATGAGAAAAG
TTGCCAAGTCCTATCGGGCCTCCTGCATGGAAGCCTAAAGTTTGGATGTT
GAAAAAGAAAACTTGAAGGTGAGGAAGCAGCTGCTTGGTTCAAAGGGCTT
TGCAGGCTTCCCGAAAAAAGGAATTGATTCTCTTGAACAAGGGTTGCAAA
AATTCCTTTCTTGGATGCATACCAACTTAAAAAATCTTGAATGGGATTGA
AAAAGGGAAAAAAAAAACCCAACCCTTAAAATTTGGGTTTTCCTTGCTTT
CTGTTTGGGGGGGGGAATTTTTCCCATTTCTTTTTCCAAAATACTTATTT
GTGGGGGGAAAAGAAA
back to top