EY665401
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY665401 vs. ExPASy Swiss-Prot
Match: PUB18_ARATH (U-box domain-containing protein 18 OS=Arabidopsis thaliana GN=PUB18 PE=2 SV=1) HSP 1 Score: 73.9442 bits (180), Expect = 1.553e-12 Identity = 33/65 (50.77%), Postives = 43/65 (66.15%), Query Frame = 3 Query: 63 CPISLELMCDPVTVCTGQTYDRPSIESWVATGNTTCPVTRSPLTDFTLIPNHTLRRLIQDWCVAN 257 CPISLE+M DPV + TG TYDR SI W +GN TCP+T LT L+ N ++R++I+ C N Sbjct: 294 CPISLEIMTDPVVIETGHTYDRSSITKWFGSGNITCPITGKILTSTELVDNVSVRQVIRKHCKTN 358
BLAST of EY665401 vs. ExPASy Swiss-Prot
Match: PUB5_ARATH (U-box domain-containing protein 5 OS=Arabidopsis thaliana GN=PUB5 PE=2 SV=2) HSP 1 Score: 72.4034 bits (176), Expect = 4.518e-12 Identity = 29/71 (40.85%), Postives = 44/71 (61.97%), Query Frame = 3 Query: 45 IPYHFRCPISLELMCDPVTVCTGQTYDRPSIESWVATGNTTCPVTRSPLTDFTLIPNHTLRRLIQDWCVAN 257 +P F+C +S +M DPV + +G T++R I+ W GN +CP+++ L DFTL PN L+ I +WC N Sbjct: 181 LPEKFKCTLSRTVMYDPVIISSGNTFERMQIQKWFDEGNDSCPISKRKLDDFTLKPNVELKSQISEWCAKN 251
BLAST of EY665401 vs. ExPASy Swiss-Prot
Match: PUB54_ARATH (U-box domain-containing protein 54 OS=Arabidopsis thaliana GN=PUB54 PE=2 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 5.901e-12 Identity = 30/70 (42.86%), Postives = 42/70 (60.00%), Query Frame = 3 Query: 57 FRCPISLELMCDPVTVCTGQTYDRPSIESWVATGNTTCPVTRSPLTDFTLIPNHTLRRLIQDWCVANRSF 266 F+CPIS+E+M DP G TY+ W+ +G T P T PL + L+PNHTLR +I+DW N ++ Sbjct: 237 FKCPISMEIMRDPHVAADGFTYEAEEFRKWLRSGGRTSPKTNKPLENHNLVPNHTLRIIIKDWLEKNPNY 306
BLAST of EY665401 vs. ExPASy Swiss-Prot
Match: PUB19_ARATH (U-box domain-containing protein 19 OS=Arabidopsis thaliana GN=PUB19 PE=2 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 1.006e-11 Identity = 32/66 (48.48%), Postives = 43/66 (65.15%), Query Frame = 3 Query: 60 RCPISLELMCDPVTVCTGQTYDRPSIESWVATGNTTCPVTRSPLTDFTLIPNHTLRRLIQDWCVAN 257 RCPISLE+M DPV + +G TYDR SI W A+GN TCP T L L+ N +++++IQ + N Sbjct: 283 RCPISLEIMSDPVVLESGHTYDRSSITKWFASGNITCPKTGKTLVSTVLVDNFSVKQVIQSYSKQN 348
BLAST of EY665401 vs. ExPASy Swiss-Prot
Match: PUB48_ARATH (U-box domain-containing protein 48 OS=Arabidopsis thaliana GN=PUB48 PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 4.995e-11 Identity = 30/75 (40.00%), Postives = 45/75 (60.00%), Query Frame = 3 Query: 36 SVQIPYHFRCPISLELMCDPVTVCTGQTYDRPSIESWVATGNTTCPVTRSPLTDFTLIPNHTLRRLIQDWCVANR 260 SV++P F+C +S +M DPV + +GQTY++ I W+ + TCP + L L PNH + LI WC+AN+ Sbjct: 71 SVEVPKEFKCTLSKTIMIDPVIIFSGQTYEKRYITEWL-NHDLTCPTAKQVLYRVCLTPNHLINELITRWCLANK 144
BLAST of EY665401 vs. ExPASy Swiss-Prot
Match: PUB32_ARATH (U-box domain-containing protein 32 OS=Arabidopsis thaliana GN=PUB32 PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 4.995e-11 Identity = 30/66 (45.45%), Postives = 39/66 (59.09%), Query Frame = 3 Query: 48 PYHFRCPISLELMCDPVTVCTGQTYDRPSIESWVATGNTTCPVTRSPLTDFTLIPNHTLRRLIQDW 245 P H+ CPI E+M DP+ G TY+ +I W+A G+ T P+T + D LIPNH L IQDW Sbjct: 736 PSHYLCPIFQEVMKDPLIAADGFTYEAEAIREWLANGHDTSPMTNLKMEDCNLIPNHALHLAIQDW 801 The following BLAST results are available for this feature:
BLAST of EY665401 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 36
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY665401 ID=EY665401; Name=EY665401; organism=Citrus sinensis; type=EST; length=984bpback to top |