CX043498

Overview
NameCX043498
Unique NameCX043498
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length789
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1260 contig Csv1_Contig1260:435..1222. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX043498 vs. ExPASy Swiss-Prot
Match: CB21_ARATH (Chlorophyll a-b binding protein 165/180, chloroplastic OS=Arabidopsis thaliana GN=LHCP-A PE=1 SV=1)

HSP 1 Score: 352.443 bits (903), Expect = 1.597e-96
Identity = 179/253 (70.75%), Postives = 199/253 (78.66%), Query Frame = 3
Query:   42 ATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTV---KSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRI-XXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVXAIVTGKGPIENLYDHIADPV 788
            +T A+   AFAG+      N       V   GR+TMR+TV   K    S WYG DR KYLGPFS ++PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPE+L++NGVKFGEAVWFKAG+QIFS+GGLDYLGNP+L+HAQSILAIWA QV+LMG VEGYR+                 +FDPLGLA DP+ FAELKVKELKNGRLAMFSMFGFFV AIVTGKGPIENL DH+ADPV
Sbjct:    4 STMALSSPAFAGKAV----NLSPAASEVLGSGRVTMRKTVAKPKGPSGSPWYGSDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGNGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLADPV 252          
BLAST of CX043498 vs. ExPASy Swiss-Prot
Match: CB22_PETSP (Chlorophyll a-b binding protein 22L, chloroplastic OS=Petunia sp. GN=CAB22L PE=3 SV=1)

HSP 1 Score: 352.058 bits (902), Expect = 2.085e-96
Identity = 174/253 (68.77%), Postives = 196/253 (77.47%), Query Frame = 3
Query:   42 ATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTV-KSTPQSI---WYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVXAIVTGKGPIENLYDHIADPV 788
            AT A+  S FAG+      +       +   G+ TMR+T  K+ P S    WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPE+ ++NGVKFGEAVW KAG+QIFSEGGLDYLGNP+L+HAQSILAIWACQV+LMG VEGYR+                +FDPLGLA+DP+ FAELKVKE KNGRLAMFSMFGFF+ AIVTGKGP+ENL DH+ DPV
Sbjct:    4 ATMALSSSTFAGKVVKLSPSSSE----ITGNGKATMRKTATKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFARNGVKFGEAVWLKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVLLMGAVEGYRVAGGPLGVVVDPLYPGGSFDPLGLAEDPEAFAELKVKETKNGRLAMFSMFGFFIQAIVTGKGPLENLADHLVDPV 252          
BLAST of CX043498 vs. ExPASy Swiss-Prot
Match: CB21_SINAL (Chlorophyll a-b binding protein 1, chloroplastic OS=Sinapis alba GN=CAB1 PE=3 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 4.646e-96
Identity = 179/252 (71.03%), Postives = 201/252 (79.76%), Query Frame = 3
Query:   42 ATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQS--IWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRI-XXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVXAIVTGKGPIENLYDHIADPV 788
            +T A+   AFAG+ A++ S       G    GR+TMR+TVK T  S   WYG DR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPE+L++NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG VEGYR+                 +FDPLGLA DP+ FAELKVKE+KNGRLAMFSMFGFFV AIVTGKGP+ENL DH+ADPV
Sbjct:    4 STMALSSPAFAGK-AVKLSPGASEVFGT---GRVTMRKTVKPTGPSGSPWYGSDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGEGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV 251          
BLAST of CX043498 vs. ExPASy Swiss-Prot
Match: CB21_SOYBN (Chlorophyll a-b binding protein, chloroplastic (Fragment) OS=Glycine max PE=2 SV=1)

HSP 1 Score: 348.206 bits (892), Expect = 3.011e-95
Identity = 169/220 (76.82%), Postives = 185/220 (84.09%), Query Frame = 3
Query:  135 GRITMRRTVKSTPQS--IWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVXAIVTGKGPIENLYDHIADPV 788
            GR++MR+T   T  S   WYGPDR KYLGPFS + PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPE+L++NGVKFGEA WFKAG+QIFSEGGLDYLGN +LIHAQSILAIWA QV+LMG VEGYRI                +FDPL LADDP+ FAELKVKE+KNGRLAMFSMFGFFV AIVTGKGP+ENL DH+A+PV
Sbjct:   11 GRVSMRKTASKTVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEASWFKAGSQIFSEGGLDYLGNQSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLALADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLAEPV 230          
BLAST of CX043498 vs. ExPASy Swiss-Prot
Match: CB21_ORYSJ (Chlorophyll a-b binding protein 1, chloroplastic OS=Oryza sativa subsp. japonica GN=CAB1R PE=2 SV=2)

HSP 1 Score: 347.436 bits (890), Expect = 5.137e-95
Identity = 172/222 (77.48%), Postives = 185/222 (83.33%), Query Frame = 3
Query:  138 RITMRRTVK-----STPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVXAIVTGKGPIENLYDHIADPV 788
            RITMR+T       ++  S WYG DR  YLGP S + PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPE+L++NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+LIHAQSILAIWA QVVLMG VEGYRI                AFDPLGLADDP+ FAELKVKE+KNGRLAMFSMFGFFV AIVTGKGP+ENL DH+ADPV
Sbjct:   29 RITMRKTAAKPKPAASSGSPWYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWAVQVVLMGAVEGYRIAGGPLGEVVDPLYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV 250          
BLAST of CX043498 vs. ExPASy Swiss-Prot
Match: CB21_SILPR (Chlorophyll a-b binding protein, chloroplastic (Fragment) OS=Silene pratensis PE=2 SV=2)

HSP 1 Score: 345.51 bits (885), Expect = 1.952e-94
Identity = 165/206 (80.10%), Postives = 178/206 (86.41%), Query Frame = 3
Query:   39 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQF 656
            MATS IQQSAFAGQT L+  NE VRKVG  +GGR++MRRT+KS P+SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPE+L+KNGVKFGEAVWFKAG+QIF EGGLDYLGNPNL+HAQSILAIWACQVVLMG VEGYR+                AFDPLGLA+DP+ F
Sbjct:    1 MATSTIQQSAFAGQTLLKPQNELVRKVG-GNGGRVSMRRTIKSAPESIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAKNGVKFGEAVWFKAGSQIFQEGGLDYLGNPNLVHAQSILAIWACQVVLMGAVEGYRVGGGPLGEGLDQLYPGGAFDPLGLAEDPEAF 205          
BLAST of CX043498 vs. ExPASy Swiss-Prot
Match: CB21_PEA (Chlorophyll a-b binding protein AB96 (Fragment) OS=Pisum sativum GN=AB96 PE=1 SV=1)

HSP 1 Score: 342.043 bits (876), Expect = 2.158e-93
Identity = 164/208 (78.85%), Postives = 180/208 (86.54%), Query Frame = 3
Query:  165 STPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVXAIVTGKGPIENLYDHIADPV 788
            ++  S W+GPD  KYLGPFS ++PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWA QV+LMG VEGYRI                +FDPLGLA+ P+ FAELKVKELKNGRLAMFSMFGFFV AIVTGKGP+ENL DH+ADPV
Sbjct:    6 ASSSSPWHGPDGVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEVPEAFAELKVKELKNGRLAMFSMFGFFVPAIVTGKGPLENLADHLADPV 213          
BLAST of CX043498 vs. ExPASy Swiss-Prot
Match: CB21_WHEAT (Chlorophyll a-b binding protein, chloroplastic OS=Triticum aestivum GN=WHAB1.6 PE=3 SV=1)

HSP 1 Score: 339.347 bits (869), Expect = 1.399e-92
Identity = 171/252 (67.86%), Postives = 194/252 (76.98%), Query Frame = 3
Query:   45 TSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQ----SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVXAIVTGKGPIENLYDHIADPV 788
            T ++  S+FAG+      +  +  +G A   R+ MR+T     Q    S WYG DR  YLGP S + PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPE+L++NGVKFGEA WFKAG+QIFS+GGLDYLGNP+L+HAQS+LAIWACQVVLMG VEGYRI                +FDPLGLA+ P  FAELKVKE+KNGRLAMFSMFGFFV AIVTGKGP+E+L DHIADPV
Sbjct:    5 TMSLSSSSFAGKAVKNLPSSAL--IGDA---RVNMRKTAAKAKQVSSSSPWYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAGWFKAGSQIFSDGGLDYLGNPSLVHAQSLLAIWACQVVLMGAVEGYRIAGGPLGEIVDPLYPGGSFDPLGLAERPQAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLEDLADHIADPV 251          
BLAST of CX043498 vs. ExPASy Swiss-Prot
Match: CB48_MAIZE (Chlorophyll a-b binding protein 48, chloroplastic OS=Zea mays GN=CAB48 PE=3 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 1.108e-89
Identity = 169/253 (66.80%), Postives = 186/253 (73.52%), Query Frame = 3
Query:   42 ATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTV-KSTPQ---SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVXAIVTGKGPIENLYDHIADPV 788
            AT AI   A  G+ A    + F         GRITMR+T  K  P    S WYG DR  YLGP S   PSYLTGEFPGDYGWDT GLSADPETFAKNRELEVIH RWA+   LGCVFPE+L++NGVKFGE VWFKAG+QIFSEGGL + GNP+L+HAQSILAIWACQVVLMG VEGY +                +FDPLGL DDP++FAELKVKE+KNGRLAMFSMFGFFV AIVTGKGPIENL DH+ DPV
Sbjct:    4 ATMAITSRALVGKPAAGTRDVFGE-------GRITMRKTAAKPKPARSGSPWYGADRVLYLGPLSGSPPSYLTGEFPGDYGWDTEGLSADPETFAKNRELEVIHCRWAIAVGLGCVFPELLARNGVKFGEGVWFKAGSQIFSEGGLSHPGNPSLVHAQSILAIWACQVVLMGAVEGYHVAGGRLGEVVDPLYLGGSFDPLGLGDDPERFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLTDPV 249          
BLAST of CX043498 vs. ExPASy Swiss-Prot
Match: CB22_SOYBN (Chlorophyll a-b binding protein 2, chloroplastic OS=Glycine max GN=CAB2 PE=3 SV=1)

HSP 1 Score: 328.561 bits (841), Expect = 2.469e-89
Identity = 172/251 (68.53%), Postives = 192/251 (76.49%), Query Frame = 3
Query:   42 ATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQS--IWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVXAIVTGKGPIENLYDHIADPV 788
            +T A+  S+ AGQ      +    ++GV   GR++MR+T   T  S   WYGPDR KYLGPFS + PSYLTGEF G        LSADPETFAKNRELEVIHSRWAMLGALGCVFPE+L++NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+LIHAQSILAIWA QV+LMG VEGYRI                +FDPLGLADDP+  AELKVKELKNGRLAMFSMFGFFV AIVTGKGP+ENL DH+ADPV
Sbjct:    4 STMALSSSSLAGQAMKLAPS--TPELGV---GRVSMRKTAPKTVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFHG--------LSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEALAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPV 241          
The following BLAST results are available for this feature:
BLAST of CX043498 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 82
Match NameE-valueIdentityDescription
CB21_ARATH1.597e-9670.75Chlorophyll a-b binding protein 165/180, chloropla... [more]
CB22_PETSP2.085e-9668.77Chlorophyll a-b binding protein 22L, chloroplastic... [more]
CB21_SINAL4.646e-9671.03Chlorophyll a-b binding protein 1, chloroplastic O... [more]
CB21_SOYBN3.011e-9576.82Chlorophyll a-b binding protein, chloroplastic (Fr... [more]
CB21_ORYSJ5.137e-9577.48Chlorophyll a-b binding protein 1, chloroplastic O... [more]
CB21_SILPR1.952e-9480.10Chlorophyll a-b binding protein, chloroplastic (Fr... [more]
CB21_PEA2.158e-9378.85Chlorophyll a-b binding protein AB96 (Fragment) OS... [more]
CB21_WHEAT1.399e-9267.86Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB48_MAIZE1.108e-8966.80Chlorophyll a-b binding protein 48, chloroplastic ... [more]
CB22_SOYBN2.469e-8968.53Chlorophyll a-b binding protein 2, chloroplastic O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_11D12_g Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07 Citrus sinensis cDNA clone UCRCS07-11D12-G23-1-7.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX043498 ID=CX043498; Name=CX043498; organism=Citrus sinensis; type=EST; length=789bp
CTTCAGCAACAAAAGGAAAAGCTTTCGCATAAGAACATATGGCAACCTCT
GCTATCCAACAATCAGCATTTGCTGGCCAGACCGCCTTGAGGCAATCCAA
TGAGTTTGTCCGCAAGGTTGGAGTTGCTGACGGTGGCCGTATCACCATGA
GGAGGACTGTCAAATCCACTCCCCAGAGCATCTGGTACGGCCCAGACCGC
CCAAAGTACTTGGGACCATTCTCTGAGCAAACACCATCATACTTGACTGG
TGAGTTCCCTGGTGACTATGGCTGGGATACCGCTGGTTTATCAGCAGACC
CCGAGACATTTGCTAAGAACCGTGAGCTAGAGGTGATCCACAGCAGATGG
GCAATGCTTGGAGCTCTTGGCTGCGTCTTCCCTGAAATCCTCTCCAAGAA
TGGAGTGAAGTTCGGCGAAGCAGTTTGGTTCAAGGCTGGCGCTCAAATCT
TCTCTGAAGGTGGCCTTGACTATCTTGGCAACCCCAACCTCATTCATGCT
CAGAGCATTTTGGCTATCTGGGCCTGCCAGGTTGTGCTCATGGGTTTTGT
TGAAGGATACAGAATTGGTGGCGGTCCTCTTGGTGAAGGACTTGACCCAC
TTTACCCTGGTGGTGCTTTTGACCCACTTGGTTTGGCTGATGACCCCGAT
CAATTTGCTGAGTTGAAGGTCAAGGAGCTCAAGAATGGCCGTCTGGCTAT
GTTCTCCATGTTTGGATTCTTTGTTCANGCTATTGTCACTGGGAAGGGTC
CAATTGAGAACCTCTACGACCACATTGCTGATCCTGTGG
back to top