EY665198

Overview
NameEY665198
Unique NameEY665198
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1006
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER43_ARATH (Peroxidase 43 OS=Arabidopsis thaliana GN=PER43 PE=2 SV=2)

HSP 1 Score: 105.916 bits (263), Expect = 3.828e-22
Identity = 54/148 (36.49%), Postives = 84/148 (56.76%), Query Frame = 2
Query:   35 LSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYP-----EVDPALNPDHVPHMLP*CPE 463
            +SEK      G+R F  +E +K  +E  CPGVVSC+DI+ L+ RD +    GP   + TGRRDGR S   + +  +P+ +DS+ ++  +F   G++A  LV L  +H++G T C  +  RLY      + DP +NP  +P +   CP+
Sbjct:   84 ISEKNAFGHEGVRGFEIVEAVKAELEAACPGVVSCSDIVALAARDAISLANGPAYEVPTGRRDGRVSNMSLAKD-MPEVSDSIEILKAKFMQKGLNAKDLVLLSAAHTIGTTACFFMSKRLYDFLPGGQPDPTINPTFLPELTTQCPQ 230          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PERP7_BRARA (Peroxidase P7 OS=Brassica rapa PE=1 SV=3)

HSP 1 Score: 105.531 bits (262), Expect = 4.999e-22
Identity = 55/137 (40.15%), Postives = 81/137 (59.12%), Query Frame = 2
Query:    5 SLLLDSTRKTLSEKEMDRSFGM-RNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVD 412
            S+LLD T     E+    +    R F  I +IK AVE+ CPGVVSCADIL ++ RD VV LGGP   +K GRRD + +        +P  + S+S ++  F+A+G+    +VAL G+H++G++ CV    R+Y E +
Sbjct:   52 SILLDDTSSFTGEQNAGPNRNSARGFTVINDIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNVKVGRRDAKTASQAAANSNIPAPSMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCVNFRARVYNETN 188          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER41_ARATH (Peroxidase 41 OS=Arabidopsis thaliana GN=PER41 PE=2 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 6.529e-22
Identity = 58/143 (40.56%), Postives = 86/143 (60.14%), Query Frame = 2
Query:    2 ASLLL--DSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDPALN 424
            AS+L+  +S  K   + +++ S     F  +  IK A+E  CPGVVSCADIL  + RD V  +GGP+  +K GR+DG +S+A  ++  LP  N S+  +L  F   G     LVAL G H++G +HC +  +R++P+VDP LN
Sbjct:   75 ASVLIATNSFNKAERDDDLNESLPGDAFDIVTRIKTALELSCPGVVSCADILAQATRDLVTMVGGPFYEVKLGRKDGFESKAHKVKGNLPLANQSVPDMLSIFKKNGFTLKELVALSGGHTIGFSHCKEFSNRIFPKVDPELN 217          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER36_ARATH (Peroxidase 36 OS=Arabidopsis thaliana GN=PER36 PE=2 SV=2)

HSP 1 Score: 104.76 bits (260), Expect = 8.527e-22
Identity = 61/159 (38.36%), Postives = 85/159 (53.46%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSF-GMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CP 460
            AS+LLDS+    SEK  + +    R F  I+ IK A+E ECP  VSCAD+L L  RD +V  GGP   +  GRRD R++      + +P    ++  +L  F   G+D   LVALLGSH++G + C+    RLY      + D  LN D+   +   CP
Sbjct:   90 ASVLLDSSGTMESEKRSNANRDSARGFEVIDEIKSALENECPETVSCADLLALVARDSIVICGGPSWEVYLGRRDAREASLIGSMENIPSPESTLQTILTMFNFQGLDLTDLVALLGSHTIGNSRCIGFRQRLYNHTGNNDPDQTLNQDYASMLQQGCP 248          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER1_ORYSJ (Peroxidase 1 OS=Oryza sativa subsp. japonica GN=PRX74 PE=2 SV=2)

HSP 1 Score: 104.375 bits (259), Expect = 1.114e-21
Identity = 58/159 (36.48%), Postives = 85/159 (53.46%), Query Frame = 2
Query:    5 SLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY--------PEVDPALNPDHVPHMLP*C 457
            S+LLDS   + +EK+   +  +R F ++E +K AVE+ CPG VSCAD+L L  RD V    GP+  +  GRRDGR S A   +Q LP    + + + + FAA  +D   LV L   H++G +HC     RLY         ++DP L   ++  +   C
Sbjct:   74 SVLLDSAGNSTAEKDATPNQTLRGFGFVERVKAAVEKACPGTVSCADVLALMARDAVWLSKGPFWAVPLGRRDGRVSIANETDQ-LPPPTANFTELTQMFAAKNLDLKDLVVLSAGHTIGTSHCFSFTDRLYNFTGLDNAHDIDPTLELQYMARLRSKC 231          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER55_ARATH (Peroxidase 55 OS=Arabidopsis thaliana GN=PER55 PE=1 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.455e-21
Identity = 58/157 (36.94%), Postives = 92/157 (58.60%), Query Frame = 2
Query:   38 SEKEMD--RSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRL-----YPEVDPALNPDHVPHMLP*CPECIPDPKAV 487
            +EK+ D  +S     F  +   K AVE +CPGVVSCADIL L+ RD VV +GGP   ++ GRRDG  S+A  +   LP+    +  +++ FA+ G+    ++AL G+H++G +HC +  +RL     +  VDP ++P +   ++  C +  P+P AV
Sbjct:   92 AEKDADDNKSLAGDGFDTVIKAKTAVESQCPGVVSCADILALAARDVVVLVGGPEFKVELGRRDGLVSKASRVTGKLPEPGLDVRGLVQIFASNGLSLTDMIALSGAHTIGSSHCNRFANRLHNFSTFMPVDPTMDPVYAQQLIQACSD--PNPDAV 246          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER11_ARATH (Peroxidase 11 OS=Arabidopsis thaliana GN=PER11 PE=1 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.455e-21
Identity = 49/144 (34.03%), Postives = 83/144 (57.64%), Query Frame = 2
Query:    5 SLLLDSTRKTLSEKEMDRSFG-MRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYP--EVDPALNP 427
            S+LLD T     EK+   +   ++ ++ ++ IK  +E ECPGVVSCAD+L +  RD  + +GGPY  +  GR+D + +  E+    LP   + +  ++ +F + G+    +VAL+G+H++G+  C     R+Y   +V  ALNP
Sbjct:   80 SVLLDETETLQGEKKASPNINSLKGYKIVDRIKNIIESECPGVVSCADLLTIGARDATILVGGPYWDVPVGRKDSKTASYELATTNLPTPEEGLISIIAKFYSQGLSVEDMVALIGAHTIGKAQCRNFRSRIYGDFQVTSALNP 223          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER49_ARATH (Peroxidase 49 OS=Arabidopsis thaliana GN=PER49 PE=2 SV=2)

HSP 1 Score: 103.219 bits (256), Expect = 2.481e-21
Identity = 71/221 (32.13%), Postives = 108/221 (48.87%), Query Frame = 2
Query:    5 SLLLDSTRKTLSEKEMD-RSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPE-----VDPALNPDHVPHMLP*CPECIPDP-KAVQYVRNDRGTPLVLEQHLL*GTYWTTKGLIEVDLHLTPEQEEKTLLLKKWAKIQ 646
            SLLLDS+ +  +EK  +  S   R F  ++ IK  +E++CPG VSCAD+L L+ RD  V  GGP   +  GRRD R +        +P  N++   +L +F   G+D   LVAL GSH++G + C     RLY +      D  L      ++   CP+   D   +V  + +         ++L+       KGL+  D  L    E+   L+KK+A+ Q
Sbjct:   80 SLLLDSSGRVATEKNSNPNSKSARGFDVVDQIKAELEKQCPGTVSCADVLTLAARDSSVLTGGPSWVVPLGRRDSRSASLSQSNNNIPAPNNTFQTILSKFNRQGLDITDLVALSGSHTIGFSRCTSFRQRLYNQSGNGSPDMTLEQSFAANLRQRCPKSGGDQILSVLDIISAASFDNSYFKNLI-----ENKGLLNSDQVLFSSNEKSRELVKKYAEDQ 295          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER3_ARATH (Peroxidase 3 OS=Arabidopsis thaliana GN=PER3 PE=1 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 2.481e-21
Identity = 57/152 (37.50%), Postives = 89/152 (58.55%), Query Frame = 2
Query:    5 SLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEV-----DPALNPDHVPHM 445
            S+L++ST    +E++   +  +R F +I+ IK  +E +CPG+VSCADI+ L+ RD VV  GGP   + TGRRDGR S A      +P    +++ +   FA  G+D   LV L G+H++G +HC    +RLY        DPAL+ ++  ++
Sbjct:   76 SVLINSTSGN-AERDATPNLTVRGFGFIDAIKSVLEAQCPGIVSCADIIALASRDAVVFTGGPNWSVPTGRRDGRISNAAEALANIPPPTSNITNLQTLFANQGLDLKDLVLLSGAHTIGVSHCSSFTNRLYNFTGRGGQDPALDSEYAANL 226          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER26_ARATH (Probable peroxidase 26 OS=Arabidopsis thaliana GN=PER26 PE=2 SV=2)

HSP 1 Score: 102.449 bits (254), Expect = 4.232e-21
Identity = 75/219 (34.25%), Postives = 111/219 (50.68%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CP----ECIPDPKAVQYVRNDRGTPLVLEQHLL*GTYW----TTKGLIEVDLHLTPEQEEKTL 619
            AS+LL+      SEK   ++ G+  F  I+ IK  +E+ CPGVVSCADIL L+ RD V   G P  P+ TGRRDG  S  + ++  LP  + S    +  F + G++   +  LLGSHS+GRTHC  +V RLY      +  P +N   +  M   CP    +   DP  + Y+  D G+      H    +++    + K ++EVD  L    + K +
Sbjct:   86 ASVLLEGPN---SEKMAPQNRGLGGFVLIDKIKIVLEQRCPGVVSCADILNLATRDAVHLAGAPSYPVFTGRRDGLTSDKQTVD--LPSPSISWDQAMSYFKSRGLNVLDMATLLGSHSMGRTHCSYVVDRLYNYNKTGKPSPTMNKYFLSEMAKQCPPRTRKGQTDP--LVYLNPDSGS-----NHSFTSSFYSRILSNKSVLEVDQQLLYNDDTKQI 292          
The following BLAST results are available for this feature:
BLAST of EY665198 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 104
Match NameE-valueIdentityDescription
PER43_ARATH3.828e-2236.49Peroxidase 43 OS=Arabidopsis thaliana GN=PER43 PE=... [more]
PERP7_BRARA4.999e-2240.15Peroxidase P7 OS=Brassica rapa PE=1 SV=3[more]
PER41_ARATH6.529e-2240.56Peroxidase 41 OS=Arabidopsis thaliana GN=PER41 PE=... [more]
PER36_ARATH8.527e-2238.36Peroxidase 36 OS=Arabidopsis thaliana GN=PER36 PE=... [more]
PER1_ORYSJ1.114e-2136.48Peroxidase 1 OS=Oryza sativa subsp. japonica GN=PR... [more]
PER55_ARATH1.455e-2136.94Peroxidase 55 OS=Arabidopsis thaliana GN=PER55 PE=... [more]
PER11_ARATH1.455e-2134.03Peroxidase 11 OS=Arabidopsis thaliana GN=PER11 PE=... [more]
PER49_ARATH2.481e-2132.13Peroxidase 49 OS=Arabidopsis thaliana GN=PER49 PE=... [more]
PER3_ARATH2.481e-2137.50Peroxidase 3 OS=Arabidopsis thaliana GN=PER3 PE=1 ... [more]
PER26_ARATH4.232e-2134.25Probable peroxidase 26 OS=Arabidopsis thaliana GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-083-B07-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665198 ID=EY665198|Name=EY665198|organism=Citrus sinensis|type=EST|length=1006bp
TGCTTCACTGCTTCTGGACTCGACTAGAAAGACCTTGTCTGAGAAGGAGA
TGGACAGGAGCTTTGGTATGAGGAACTTCAGGTACATTGAGAACATCAAA
GAAGCTGTTGAAAGAGAGTGCCCTGGTGTTGTTTCCTGTGCTGATATTCT
TGTCCTGTCCGGTAGAGATGGCGTTGTTGCGCTTGGAGGCCCTTACATTC
CTCTCAAGACAGGAAGAAGAGATGGTAGAAAAAGCAGAGCAGAGATACTT
GAGCAGTATCTCCCAGATCACAACGACAGCATGTCTGTTGTTCTTGAGAG
GTTTGCAGCCATTGGCATTGACGCCCCTGGACTTGTTGCTCTGCTAGGAT
CTCACAGTGTTGGCAGAACTCATTGTGTGAAGCTGGTGCACCGTCTGTAC
CCAGAAGTTGACCCTGCACTGAACCCTGACCATGTTCCGCATATGCTCCC
ATAATGTCCTGAATGCATCCCAGACCCCAAGGCTGTTCAGTATGTGAGGA
ATGACCGTGGCACCCCCCTGGTGCTGGAACAACACCTACTATAGGGAACT
TATTGGACAACAAAGGGCTTGATTGAGGTTGATCTTCACCTAACCCCCGA
ACAAGAGGAAAAGACCTTATTGTTAAAAAAATGGGCCAAAATCCAAGAAT
TAACTTCCTTAAGGGAATTTTCAAGAACCATTTCCCCTCCTTTTTGAAAA
AAACCCCTCTCCCAAGGTAAAAAGGGGGGAAATCCCAAAGGGTTGGGAAT
TTTTGCCCCAAAAAACCCCCCCAAAAAAATCCCAAAGTTATCTAAAAACA
CTTGTTTTTTTACTCCACAACAAAATTTAAATAACCCCCCCAATTTTTTC
TTTTCCCTTTGTTTTTTTTTCTCATAAAGAGAAAAAAAAAAAAAAAAGGG
GGGGGGAAATAAGCCCCCCTCCCCAAAAAAAAAAAAGGGGTTTTTTTTCT
TAAAAAAAATAAGGGTTGTTTTTGTTTCTCCCCCTCGCGGGGGAAAAGAG
AAGAGT
back to top