EY665198

Overview
NameEY665198
Unique NameEY665198
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1006
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PERX_NICSY (Lignin-forming anionic peroxidase OS=Nicotiana sylvestris PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 3.583e-20
Identity = 55/134 (41.04%), Postives = 77/134 (57.46%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSFGM-RNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY 400
            AS+LLD T    SEK    + G  R F  IE+ K  VE+ CPGVVSCADIL ++ RD   A+GGP   +K GRRD   +   + E  LP   D ++ ++  FA+ G+    +VAL G+H++G+  C     R+Y
Sbjct:   78 ASILLDETPSIESEKTALPNLGSARGFGIIEDAKREVEKICPGVVSCADILTVAARDASAAVGGPSWTVKLGRRDSTTASKTLAETDLPGPFDPLNRLISSFASKGLSTRDMVALSGAHTIGQAQCFLFRDRIY 211          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER47_ARATH (Peroxidase 47 OS=Arabidopsis thaliana GN=PER47 PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 6.111e-20
Identity = 51/132 (38.64%), Postives = 76/132 (57.58%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRL 397
            AS+LLDST+   +EK+   +  +R +  I++ KE +E  CPGVVSCADI+ ++ RD V   GGPY  +  GR DG++S+ E     LP    + S +++ F   G     +VAL G+H++G   C     RL
Sbjct:   75 ASILLDSTKDNTAEKDSPANLSLRGYEIIDDAKEKIENRCPGVVSCADIVAMAARDAVFWAGGPYYDIPKGRFDGKRSKIEDTRN-LPSPFLNASQLIQTFGQRGFTPQDVVALSGAHTLGVARCSSFKARL 205          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER40_ARATH (Peroxidase 40 OS=Arabidopsis thaliana GN=PER40 PE=2 SV=2)

HSP 1 Score: 98.5969 bits (244), Expect = 6.111e-20
Identity = 50/135 (37.04%), Postives = 74/135 (54.81%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSFG-MRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYP 403
            AS+LLD T   + EK    +   +R F  I++IK  +E  CP  VSCADIL ++ RD VV  GGP   ++ GR+D R +  +     LP  N ++S ++  F  +G+    +VAL G H++G+  C     RL P
Sbjct:   99 ASVLLDDTEGLVGEKTAPPNLNSLRGFEVIDSIKSDIESVCPETVSCADILAMAARDSVVVSGGPRWEVEVGRKDSRTASKQAATNGLPSPNSTVSTLISTFQNLGLSQTDMVALSGGHTLGKARCTSFTARLQP 233          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER23_ARATH (Peroxidase 23 OS=Arabidopsis thaliana GN=PER23 PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 6.111e-20
Identity = 66/205 (32.20%), Postives = 105/205 (51.22%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEM-DRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPG-LVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CPECIPDPKAVQYVRNDRGTPLVLEQHLL*GTYWTT----KGLIEVD 583
            AS+LLD++    +EK+       +R F  I+ +K A+ER CP  VSCADI+ ++ +  V+  GGP+ P+  GRRD  ++   +    LP    +++ +   FA +G++ P  LVAL G H+ G+  C  +  RLY        DP+LNP ++  +   CP+   +      V  D  TP   ++      Y+T     KGLI+ D
Sbjct:   80 ASILLDNSTSFRTEKDAAPNKNSVRGFDVIDRMKAAIERACPRTVSCADIITIASQISVLLSGGPWWPVPLGRRDSVEAFFALANTALPSPFSTLTQLKTAFADVGLNRPSDLVALSGGHTFGKAQCQFVTPRLYNFNGTNRPDPSLNPTYLVELRRLCPQ---NGNGTVLVNFDSVTPTTFDRQ-----YYTNLLNGKGLIQSD 276          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER14_ARATH (Peroxidase 14 OS=Arabidopsis thaliana GN=PER14 PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.361e-19
Identity = 70/225 (31.11%), Postives = 103/225 (45.78%), Query Frame = 2
Query:    5 SLLLDSTRKTLSEKEMD-RSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPE-----VDPALNPDHVPHMLP*CPECIPDPKAVQYVRNDRGTPLVLEQHLL*GTYW----TTKGLIEVDLHLTPEQEEKTLLLKKWAKIQE 649
            SLLLD++   ++EK  +  S   R F  ++ IK A+E ECP  VSCAD L L+ RD  V  GGP   +  GRRD   +      + LP+ ++    +  RF+  G++   LVAL GSH++G + C     RLY +      D  L   +   +   CP    D    +   N  G            +Y+       GL+  D  L    E+   L+KK+A+ QE
Sbjct:   85 SLLLDTSGSIVTEKNSNPNSRSARGFEVVDEIKAALENECPNTVSCADALTLAARDSSVLTGGPSWTVPLGRRDSATASRAKPNKDLPEPDNLFDTIFLRFSNEGLNLTDLVALSGSHTIGFSRCTSFRQRLYNQSGSGSPDTTLEKSYAAILRQRCPRSGGDQNLSELDINSAGR--------FDNSYFKNLIENMGLLNSDQVLFSSNEQSRELVKKYAEDQE 301          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PERE5_ARMRU (Peroxidase E5 OS=Armoracia rusticana GN=HRPE5 PE=1 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.778e-19
Identity = 69/212 (32.55%), Postives = 107/212 (50.47%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSFGM-RNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPG-LVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CPECIPDPKAVQYVRNDRGTPL----VLEQHLL*GTYWTT----KGLIEVDLHL 592
            AS+LLD+++   +EK+   +    R F  I+ +K A+ER CP  VSCADIL ++ +  V+  GGP   +  GRRD  ++  ++    LP    +++ + + FA +G++ P  LVAL G H+ GR  C+ +  RLY        DP LNP ++  +   CP            RN  GT L    V+  +     ++T     KGLI+ D  L
Sbjct:   51 ASILLDTSKSFRTEKDAAPNVNSARGFNVIDRMKTALERACPRTVSCADILTIASQISVLLSGGPSWAVPLGRRDSVEAFFDLANTALPSPFFTLAQLKKAFADVGLNRPSDLVALSGGHTFGRARCLFVTARLYNFNGTNRPDPTLNPSYLADLRRLCP------------RNGNGTVLVNFDVMTPNTFDNQFYTNLRNGKGLIQSDQEL 250          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER71_ARATH (Peroxidase 71 OS=Arabidopsis thaliana GN=PER71 PE=1 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.778e-19
Identity = 53/146 (36.30%), Postives = 81/146 (55.48%), Query Frame = 2
Query:   38 SEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY----PEVDPALNPDHVPHMLP*CPE 463
            +E+    +  ++ F  I+N K  +E  CPGVVSCADIL L+ RD V+   G    + TGRRDGR S A      LP   DS++V  ++F+A+G++   LV L+G H++G   C    +RL+       DP ++P  +  +   CP+
Sbjct:   93 TERTAGPNLNLQGFEVIDNAKTQLEAACPGVVSCADILALAARDTVILTQGTGWQVPTGRRDGRVSLASNANN-LPGPRDSVAVQQQKFSALGLNTRDLVVLVGGHTIGTAGCGVFRNRLFNTTGQTADPTIDPTFLAQLQTQCPQ 237          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER53_ARATH (Peroxidase 53 OS=Arabidopsis thaliana GN=PER53 PE=1 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.778e-19
Identity = 66/214 (30.84%), Postives = 100/214 (46.73%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSFGM-RNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CPECIPDPKAVQYVRNDRGTPLVLEQHLL*GTYWTTKGLIEVDLHLTPEQEEKTLLL 625
            AS+LLD T    SEK    +    R F  ++NIK A+E  CPGVVSC+D+L L+    V   GGP   +  GRRD   +        +P   +S+S +  +F+A+G++   LVAL G+H+ GR  C    +RL+        DP LN   +  +   CP+   +  A      D  TP   + +       +  GL++ D  L       T+ +
Sbjct:   81 ASILLDDTGSIQSEKNAGPNVNSARGFNVVDNIKTALENACPGVVSCSDVLALASEASVSLAGGPSWTVLLGRRDSLTANLAGANSSIPSPIESLSNITFKFSAVGLNTNDLVALSGAHTFGRARCGVFNNRLFNFSGTGNPDPTLNSTLLSTLQQLCPQ---NGSASTITNLDLSTPDAFDNNYF-ANLQSNDGLLQSDQELFSTTGSSTIAI 290          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER2_ZINEL (Basic peroxidase OS=Zinnia elegans GN=POD3 PE=1 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.778e-19
Identity = 55/133 (41.35%), Postives = 77/133 (57.89%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY 400
            ASLLL       SE+    + G+  +  I+  K AVER CPGVVSCADIL ++ RD  VA+GGP   ++ GRRD   S A      LP  N  +S ++  FA  G++   +VAL GSH++G+  C++   R+Y
Sbjct:   81 ASLLLSGAG---SERASPANDGVLGYEVIDAAKAAVERVCPGVVSCADILAVAARDASVAVGGPSWTVRLGRRDSTTSNAAQAATDLPRGNMVLSQLISNFANKGLNTREMVALSGSHTLGQARCIRFRGRIY 210          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER1_ZINEL (Basic peroxidase OS=Zinnia elegans GN=POD1 PE=1 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.778e-19
Identity = 55/133 (41.35%), Postives = 77/133 (57.89%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY 400
            ASLLL       SE+    + G+  +  I+  K AVER CPGVVSCADIL ++ RD  VA+GGP   ++ GRRD   S A      LP  N  +S ++  FA  G++   +VAL GSH++G+  C++   R+Y
Sbjct:   81 ASLLLSGAG---SERASPANDGVLGYEVIDAAKAAVERVCPGVVSCADILAVAARDASVAVGGPSWTVRLGRRDSTTSNAAQAATDLPRGNMVLSQLISNFANKGLNTREMVALSGSHTLGQARCIRFRGRIY 210          
The following BLAST results are available for this feature:
BLAST of EY665198 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 104
Match NameE-valueIdentityDescription
PERX_NICSY3.583e-2041.04Lignin-forming anionic peroxidase OS=Nicotiana syl... [more]
PER47_ARATH6.111e-2038.64Peroxidase 47 OS=Arabidopsis thaliana GN=PER47 PE=... [more]
PER40_ARATH6.111e-2037.04Peroxidase 40 OS=Arabidopsis thaliana GN=PER40 PE=... [more]
PER23_ARATH6.111e-2032.20Peroxidase 23 OS=Arabidopsis thaliana GN=PER23 PE=... [more]
PER14_ARATH1.361e-1931.11Peroxidase 14 OS=Arabidopsis thaliana GN=PER14 PE=... [more]
PERE5_ARMRU1.778e-1932.55Peroxidase E5 OS=Armoracia rusticana GN=HRPE5 PE=1... [more]
PER71_ARATH1.778e-1936.30Peroxidase 71 OS=Arabidopsis thaliana GN=PER71 PE=... [more]
PER53_ARATH1.778e-1930.84Peroxidase 53 OS=Arabidopsis thaliana GN=PER53 PE=... [more]
PER2_ZINEL1.778e-1941.35Basic peroxidase OS=Zinnia elegans GN=POD3 PE=1 SV... [more]
PER1_ZINEL1.778e-1941.35Basic peroxidase OS=Zinnia elegans GN=POD1 PE=1 SV... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-083-B07-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665198 ID=EY665198|Name=EY665198|organism=Citrus sinensis|type=EST|length=1006bp
TGCTTCACTGCTTCTGGACTCGACTAGAAAGACCTTGTCTGAGAAGGAGA
TGGACAGGAGCTTTGGTATGAGGAACTTCAGGTACATTGAGAACATCAAA
GAAGCTGTTGAAAGAGAGTGCCCTGGTGTTGTTTCCTGTGCTGATATTCT
TGTCCTGTCCGGTAGAGATGGCGTTGTTGCGCTTGGAGGCCCTTACATTC
CTCTCAAGACAGGAAGAAGAGATGGTAGAAAAAGCAGAGCAGAGATACTT
GAGCAGTATCTCCCAGATCACAACGACAGCATGTCTGTTGTTCTTGAGAG
GTTTGCAGCCATTGGCATTGACGCCCCTGGACTTGTTGCTCTGCTAGGAT
CTCACAGTGTTGGCAGAACTCATTGTGTGAAGCTGGTGCACCGTCTGTAC
CCAGAAGTTGACCCTGCACTGAACCCTGACCATGTTCCGCATATGCTCCC
ATAATGTCCTGAATGCATCCCAGACCCCAAGGCTGTTCAGTATGTGAGGA
ATGACCGTGGCACCCCCCTGGTGCTGGAACAACACCTACTATAGGGAACT
TATTGGACAACAAAGGGCTTGATTGAGGTTGATCTTCACCTAACCCCCGA
ACAAGAGGAAAAGACCTTATTGTTAAAAAAATGGGCCAAAATCCAAGAAT
TAACTTCCTTAAGGGAATTTTCAAGAACCATTTCCCCTCCTTTTTGAAAA
AAACCCCTCTCCCAAGGTAAAAAGGGGGGAAATCCCAAAGGGTTGGGAAT
TTTTGCCCCAAAAAACCCCCCCAAAAAAATCCCAAAGTTATCTAAAAACA
CTTGTTTTTTTACTCCACAACAAAATTTAAATAACCCCCCCAATTTTTTC
TTTTCCCTTTGTTTTTTTTTCTCATAAAGAGAAAAAAAAAAAAAAAAGGG
GGGGGGAAATAAGCCCCCCTCCCCAAAAAAAAAAAAGGGGTTTTTTTTCT
TAAAAAAAATAAGGGTTGTTTTTGTTTCTCCCCCTCGCGGGGGAAAAGAG
AAGAGT
back to top