EY665198

Overview
NameEY665198
Unique NameEY665198
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1006
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER63_ARATH (Peroxidase 63 OS=Arabidopsis thaliana GN=PER63 PE=2 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 2.322e-19
Identity = 55/174 (31.61%), Postives = 92/174 (52.87%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSFGMRN--FRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDPALNPDHVPHMLP*CPECIPDPKAVQYVRNDRGTP 517
            AS+L+ ST    +E++   +  +    F  +   K A+E  CP  VSC+DI+ ++ RD +V +GGPY  +  GRRD R S++ ++   LP  +  +S ++++F++ G     +VAL G+H++G +HC +  +R+ P      NP     +   C     DP     V ND  TP
Sbjct:   81 ASVLVSSTAFNTAERDSSINLSLPGDGFDVVIRAKTALELACPNTVSCSDIIAVAVRDLLVTVGGPYYEISLGRRDSRTSKSSLVSDLLPLPSMQISKLIDQFSSRGFSVQEMVALSGAHTIGFSHCKEFTNRVNPNNSTGYNPRFAVALKKACSNSKNDPTI--SVFNDVMTP 252          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER3_ARMRU (Peroxidase C3 OS=Armoracia rusticana GN=PRXC3 PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 3.961e-19
Identity = 66/208 (31.73%), Postives = 107/208 (51.44%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEM-DRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPG-LVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CPECIPDPKAVQYVRNDRGTPLVLEQHLL*GTYWTT----KGLIEVDLHL 592
            AS+LLD++    +EK+    +   R F  I+ +K ++ER CP  VSCAD+L ++ +  V+  GGP+ P+  GRRD  ++  ++    LP    +++ + + FA +G++ P  LVAL G H+ GR  C  +  RLY        DP L+P ++  +   CP+   +      V  D  TP   ++      Y+T     KGLI+ D  L
Sbjct:   80 ASILLDNSTSFRTEKDAAPNANSARGFGVIDRMKTSLERACPRTVSCADVLTIASQISVLLSGGPWWPVPLGRRDSVEAFFDLANTALPSPFFTLAQLKKAFADVGLNRPSDLVALSGGHTFGRAQCQFVTPRLYNFNGTNRPDPTLDPTYLVQLRALCPQ---NGNGTVLVNFDVVTPNTFDRQ-----YYTNLRNGKGLIQSDQEL 279          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER30_ARATH (Peroxidase 30 OS=Arabidopsis thaliana GN=PER30 PE=1 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 3.961e-19
Identity = 53/152 (34.87%), Postives = 85/152 (55.92%), Query Frame = 2
Query:    5 SLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHM 445
            S+L++ST    +E++   +  +R F ++E IK  +E+ CP  VSCADI+ L+ RD VVA GGP   + TGRRDGR S        +P    + + +   F   G++   LV L G+H++G +HC  +  RLY      + DP+L+  +  ++
Sbjct:   79 SVLINSTSGN-AERDAPPNLTLRGFGFVERIKALLEKVCPKTVSCADIIALTARDAVVATGGPSWSVPTGRRDGRISNKTEATNNIPPPTSNFTTLQRLFKNQGLNLKDLVLLSGAHTIGVSHCSSMNTRLYNFSTTVKQDPSLDSQYAANL 229          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER22_ARATH (Peroxidase 22 OS=Arabidopsis thaliana GN=PER22 PE=1 SV=2)

HSP 1 Score: 95.9005 bits (237), Expect = 3.961e-19
Identity = 69/208 (33.17%), Postives = 105/208 (50.48%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEM-DRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGID-APGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CPECIPDPKAVQYVRNDRGTPLVLEQHLL*GTYWTT----KGLIEVDLHL 592
            AS+LLD++    +EK+    +   R F  I+ +K A+ER CPG VSCADIL ++ +  V+  GGP+ P+  GRRD  ++   +    LP    +++ +   FA +G++    LVAL G H+ GR  C  +  RLY        DP+LNP ++  +   CP+   +      V  D  TP   +       Y+T     KGLI+ D  L
Sbjct:   80 ASILLDNSTSFRTEKDAAPNANSARGFNVIDRMKVALERACPGRVSCADILTIASQISVLLSGGPWWPVPLGRRDSVEAFFALANTALPSPFFNLTQLKTAFADVGLNRTSDLVALSGGHTFGRAQCQFVTPRLYNFNGTNSPDPSLNPTYLVELRRLCPQ---NGNGTVLVNFDVVTPDAFDSQ-----YYTNLRNGKGLIQSDQEL 279          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER18_ARATH (Peroxidase 18 OS=Arabidopsis thaliana GN=PER18 PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 3.961e-19
Identity = 47/113 (41.59%), Postives = 70/113 (61.95%), Query Frame = 2
Query:   38 SEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHC 376
            +E+    +  +  F  IE++K  +E  CPG VSCADILVL+ RD V ALGGP +P+ TGRRDGR S A  +   + D + ++  ++  F++ G+    LV L G+H++G  HC
Sbjct:   89 TERSDPGNASLGGFAVIESVKNILEIFCPGTVSCADILVLAARDAVEALGGPVVPIPTGRRDGRVSMAANVRPNIIDTDFTVDKMINIFSSKGLSVHDLVVLSGAHTIGAAHC 201          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER54_ARATH (Peroxidase 54 OS=Arabidopsis thaliana GN=PER54 PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 5.173e-19
Identity = 55/159 (34.59%), Postives = 81/159 (50.94%), Query Frame = 2
Query:    5 SLLLDSTRKTLSEKEMDRSFGM-RNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CPE 463
            SLLLD T    SEK    +    R F  +++IK A+E  CPG+VSC+DIL L+    V   GGP   +  GRRDG  +        LP   + ++ +  +F A+G+    +V+L G+H+ GR  CV   +RL+        DP LN   +  +   CP+
Sbjct:   83 SLLLDDTSSIQSEKNAPANANSTRGFNVVDSIKTALENACPGIVSCSDILALASEASVSLAGGPSWTVLLGRRDGLTANLSGANSSLPSPFEGLNNITSKFVAVGLKTTDVVSLSGAHTFGRGQCVTFNNRLFNFNGTGNPDPTLNSTLLSSLQQLCPQ 241          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER1B_ARMRU (Peroxidase C1B OS=Armoracia rusticana GN=PRXC1B PE=3 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 5.173e-19
Identity = 72/225 (32.00%), Postives = 111/225 (49.33%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKE-MDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPG-LVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CPECIPDPKAVQYVRNDRGTPLVLEQHLL*GTYWTT----KGLIEVDLHL--TPEQEEKTLLLKKWA 637
            AS+LLD+T   L+EK+ +  +   R F  ++ IK AVER CP  VSCAD+L ++ +  V   GGP   +  GRRD  ++  ++    LP    ++  + + FA +G+D P  LVAL G H+ G+  C  ++ RLY        DP LN  ++  +   CP        V +   D  TP V +       Y+      KGLI+ D  L  +P   +   L++ +A
Sbjct:   79 ASILLDNTTSFLTEKDALGNANSARGFPTVDRIKAAVERACPRTVSCADVLTIAAQQSVNLAGGPSWRVPLGRRDSLQAFLDLANANLPAPFFTLPQLKDAFAKVGLDRPSDLVALSGGHTFGKNQCRFIMDRLYNFSNTGLPDPTLNTTYLQTLRQQCPLNGNQSVLVDF---DLRTPTVFD-----NKYYVNLKEQKGLIQSDQELFSSPNATDTIPLVRSFA 295          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER15_IPOBA (Peroxidase 15 OS=Ipomoea batatas GN=pod PE=1 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 5.173e-19
Identity = 66/203 (32.51%), Postives = 98/203 (48.28%), Query Frame = 2
Query:    5 SLLLDSTRKTL-SEKE-MDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CPECIPDPKAVQYVRNDRGTPLVLEQHLL*GTYWTTKGLIEVDLHL 592
            SLLLD+   T+ SEK+ +  +   R F  ++NIK AVE  CPGVVSC DIL L+    V   GGP   +  GRRD R +        LP   ++++ + ++F  +G++   LVAL G+H+ GR  C     RL+        DP LN  ++  +   CP+             D  TP   + +       T +GL++ D  L
Sbjct:   75 SLLLDNNGTTIVSEKDALPNTNSTRGFDVVDNIKTAVENACPGVVSCVDILALASESSVSLAGGPSWNVLLGRRDRRTANQGGANTSLPSPFENLTNLTQKFTNVGLNVNDLVALSGAHTFGRAQCRTFSPRLFNFSNTGNPDPTLNTTYLATLQQICPQ---GGSGFTVTNLDPTTPDTFDNNYF-SNLQTNRGLLQSDQEL 273          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PERA2_ARMRU (Peroxidase A2 OS=Armoracia rusticana GN=HRPA2 PE=1 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 6.757e-19
Identity = 64/203 (31.53%), Postives = 96/203 (47.29%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMD-RSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CPECIPDPKAVQYVRNDRGTPLVLEQHLL*GTYWTTKGLIEVDLHL 592
            AS+LLD +    SEK     +   R F  ++NIK A+E  CPGVVSC+DIL L+    V   GGP   +  GRRD   +        +P   + +S +  +F+A+G++   LVAL G+H+ GR  C    +RL+        DP LN   +  +   CP+   +  A      D  TP   + +       +  GL++ D  L
Sbjct:   51 ASILLDDSGSIQSEKNAGPNANSARGFNVVDNIKTALENTCPGVVSCSDILALASEASVSLTGGPSWTVLLGRRDSLTANLAGANSAIPSPFEGLSNITSKFSAVGLNTNDLVALSGAHTFGRARCGVFNNRLFNFSGTNGPDPTLNSTLLSSLQQLCPQ---NGSASTITNLDLSTPDAFDNNYF-ANLQSNNGLLQSDQEL 249          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER51_ARATH (Peroxidase 51 OS=Arabidopsis thaliana GN=PER51 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 6.757e-19
Identity = 62/181 (34.25%), Postives = 94/181 (51.93%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSFGMRN--FRYIENIKEAVER--ECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CPECIPDPKAVQYVRNDRGTP 517
            AS+++ ST    +EK+ + +  +    F  +   KEAV+    C   VSCADIL ++ RD V   GGP   ++ GRRDG  S A  +   LP     ++ +   FA  G+    ++AL G+H++G  HC K+ +RLY       VDP +N D+V  +   CP+ I DP+    +  D  TP
Sbjct:   76 ASVMIASTNTNKAEKDHEDNLSLAGDGFDTVIKAKEAVDAVPNCRNKVSCADILTMATRDVVNLAGGPQYAVELGRRDGLSSSASSVTGKLPKPTFDLNQLNALFAENGLSPNDMIALSGAHTLGFAHCTKVFNRLYNFNKTNNVDPTINKDYVTELKASCPQNI-DPRVA--INMDPNTP 253          
The following BLAST results are available for this feature:
BLAST of EY665198 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 104
Match NameE-valueIdentityDescription
PER63_ARATH2.322e-1931.61Peroxidase 63 OS=Arabidopsis thaliana GN=PER63 PE=... [more]
PER3_ARMRU3.961e-1931.73Peroxidase C3 OS=Armoracia rusticana GN=PRXC3 PE=3... [more]
PER30_ARATH3.961e-1934.87Peroxidase 30 OS=Arabidopsis thaliana GN=PER30 PE=... [more]
PER22_ARATH3.961e-1933.17Peroxidase 22 OS=Arabidopsis thaliana GN=PER22 PE=... [more]
PER18_ARATH3.961e-1941.59Peroxidase 18 OS=Arabidopsis thaliana GN=PER18 PE=... [more]
PER54_ARATH5.173e-1934.59Peroxidase 54 OS=Arabidopsis thaliana GN=PER54 PE=... [more]
PER1B_ARMRU5.173e-1932.00Peroxidase C1B OS=Armoracia rusticana GN=PRXC1B PE... [more]
PER15_IPOBA5.173e-1932.51Peroxidase 15 OS=Ipomoea batatas GN=pod PE=1 SV=1[more]
PERA2_ARMRU6.757e-1931.53Peroxidase A2 OS=Armoracia rusticana GN=HRPA2 PE=1... [more]
PER51_ARATH6.757e-1934.25Peroxidase 51 OS=Arabidopsis thaliana GN=PER51 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-083-B07-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665198 ID=EY665198|Name=EY665198|organism=Citrus sinensis|type=EST|length=1006bp
TGCTTCACTGCTTCTGGACTCGACTAGAAAGACCTTGTCTGAGAAGGAGA
TGGACAGGAGCTTTGGTATGAGGAACTTCAGGTACATTGAGAACATCAAA
GAAGCTGTTGAAAGAGAGTGCCCTGGTGTTGTTTCCTGTGCTGATATTCT
TGTCCTGTCCGGTAGAGATGGCGTTGTTGCGCTTGGAGGCCCTTACATTC
CTCTCAAGACAGGAAGAAGAGATGGTAGAAAAAGCAGAGCAGAGATACTT
GAGCAGTATCTCCCAGATCACAACGACAGCATGTCTGTTGTTCTTGAGAG
GTTTGCAGCCATTGGCATTGACGCCCCTGGACTTGTTGCTCTGCTAGGAT
CTCACAGTGTTGGCAGAACTCATTGTGTGAAGCTGGTGCACCGTCTGTAC
CCAGAAGTTGACCCTGCACTGAACCCTGACCATGTTCCGCATATGCTCCC
ATAATGTCCTGAATGCATCCCAGACCCCAAGGCTGTTCAGTATGTGAGGA
ATGACCGTGGCACCCCCCTGGTGCTGGAACAACACCTACTATAGGGAACT
TATTGGACAACAAAGGGCTTGATTGAGGTTGATCTTCACCTAACCCCCGA
ACAAGAGGAAAAGACCTTATTGTTAAAAAAATGGGCCAAAATCCAAGAAT
TAACTTCCTTAAGGGAATTTTCAAGAACCATTTCCCCTCCTTTTTGAAAA
AAACCCCTCTCCCAAGGTAAAAAGGGGGGAAATCCCAAAGGGTTGGGAAT
TTTTGCCCCAAAAAACCCCCCCAAAAAAATCCCAAAGTTATCTAAAAACA
CTTGTTTTTTTACTCCACAACAAAATTTAAATAACCCCCCCAATTTTTTC
TTTTCCCTTTGTTTTTTTTTCTCATAAAGAGAAAAAAAAAAAAAAAAGGG
GGGGGGAAATAAGCCCCCCTCCCCAAAAAAAAAAAAGGGGTTTTTTTTCT
TAAAAAAAATAAGGGTTGTTTTTGTTTCTCCCCCTCGCGGGGGAAAAGAG
AAGAGT
back to top