EY665198

Overview
NameEY665198
Unique NameEY665198
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1006
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER45_ARATH (Peroxidase 45 OS=Arabidopsis thaliana GN=PER45 PE=1 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.403e-16
Identity = 49/143 (34.27%), Postives = 76/143 (53.15%), Query Frame = 2
Query:   53 DRSFGMRNFRYIENIKEAVERE--CPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CP 460
            D S     F  +   K+AV+    C   VSCADIL L+ R+ VV  GGP  P++ GRRDGR S    ++  LP    +++ +   F+  G+    ++AL G+H++G  HC K+  R+Y       +DP++N  +V  +   CP
Sbjct:   91 DMSLAGDGFDTVVKAKQAVDSNPNCRNKVSCADILALATREVVVLTGGPSYPVELGRRDGRISTKASVQSQLPQPEFNLNQLNGMFSRHGLSQTDMIALSGAHTIGFAHCGKMSKRIYNFSPTTRIDPSINRGYVVQLKQMCP 233          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER44_ARATH (Peroxidase 44 OS=Arabidopsis thaliana GN=PER44 PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.403e-16
Identity = 55/143 (38.46%), Postives = 74/143 (51.75%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALL-GSHSVGRTHCVKLVHRLYPEVDPALNP 427
            ASLL+D      SEK    +  +R +  I+  K  +E  CP  VSCADI+ L+ RD V   GGP   + TGRRDG +S     +  LP     +S  ++ FAA G++   +V L+ G HSVG  HC     RL    D A+ P
Sbjct:   71 ASLLIDPRPGRPSEKSTGPNASVRGYEIIDEAKRQLEAACPRTVSCADIVTLATRDSVALAGGPRFSVPTGRRDGLRSNPN--DVNLPGPTIPVSASIQLFAAQGMNTNDMVTLIGGGHSVGVAHCSLFQDRL---SDRAMEP 208          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER9_ARATH (Peroxidase 9 OS=Arabidopsis thaliana GN=PER9 PE=1 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 3.139e-16
Identity = 49/134 (36.57%), Postives = 68/134 (50.75%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMD-RSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY 400
            AS+LLD +    SEK        +R F+ I+ IK  +E+ CP  VSCADIL L+ R   +  GGP   L  GRRD R +        +P  N ++  +L  F   G++   LV+L G H++G   C     RLY
Sbjct:   94 ASILLDDSATIRSEKNAGPNKNSVRGFQVIDEIKAKLEQACPQTVSCADILALAARGSTILSGGPSWELPLGRRDSRTASLNGANTNIPAPNSTIQNLLTMFQRKGLNEEDLVSLSGGHTIGVARCTTFKQRLY 227          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER66_MAIZE (Peroxidase 66 OS=Zea mays GN=PER66 PE=1 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 5.354e-16
Identity = 51/137 (37.23%), Postives = 74/137 (54.01%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVD 412
            ASLLL+ T    S+   + +   R F  + +IK  VE  CPG+VSCADIL ++ RDGVVALGGP   +  GRRD   S A      LP    S+  +L  +    ++   +VAL G+H++G+  C      +Y + +
Sbjct:   80 ASLLLNDTSGEQSQGP-NLTLNPRGFVVVNSIKAQVESVCPGIVSCADILAVAARDGVVALGGPSWTVLLGRRDSTASFAGQTSD-LPPPTSSLGQLLSAYNKKNLNPTDMVALSGAHTIGQAQCSSFNDHIYNDTN 214          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER12_ARATH (Peroxidase 12 OS=Arabidopsis thaliana GN=PER12 PE=1 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 9.132e-16
Identity = 56/170 (32.94%), Postives = 81/170 (47.65%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSFGMRN--FRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRK-SRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDPALNPDHVPHMLP*CPECIPDPKAVQYVRN 502
            AS+LL  +     E+    +  +R   F  I N++  V+++C  VVSC+DIL L+ RD VV  GGP   +  GRRD    +  E     LP    + S ++  FA   ++   LVAL G H++G  HC     RLYP  DP +N      +   CP        V  +R+
Sbjct:   93 ASVLLAGSASGPGEQSSIPNLTLRQQAFVVINNLRALVQKKCGQVVSCSDILALAARDSVVLSGGPDYAVPLGRRDSLAFASQETTLNNLPPPFFNASQLIADFANRNLNITDLVALSGGHTIGIAHCPSFTDRLYPNQDPTMNQFFANSLKRTCPTANSSNTQVNDIRS 262          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER1_WHEAT (Peroxidase OS=Triticum aestivum PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.657e-15
Identity = 47/132 (35.61%), Postives = 68/132 (51.52%), Query Frame = 2
Query:   68 MRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYPEVDPALNPDHVPHMLP*CPE 463
            +R F  I+NIK  +E  C   VSCADIL ++ RD VVALGGP   +  GRRD   + A +    LP  + S S +   F    ++   +VAL G+H++G+  C     R+Y   D  +N      +   CP+
Sbjct:   90 LRGFGVIDNIKTQLESVCKQTVSCADILTVAARDSVVALGGPSWTVPLGRRDSTTASASLANSDLPGPSSSRSQLEAAFLKKNLNTVDMVALSGAHTIGKAQCSNFRTRIYGG-DTNINTAFATSLKANCPQ 220          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER35_ARATH (Peroxidase 35 OS=Arabidopsis thaliana GN=PER35 PE=1 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 3.470e-15
Identity = 55/169 (32.54%), Postives = 88/169 (52.07%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSFGMRN--FRYIENIKEAVERE--CPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLYP-----EVDPALNPDHVPHMLP*CPECIPDPK 481
            AS+++ ST K  +EK+   +  +    F  +   K+A++    C   VSCADIL L+ RD VVA GGP   ++ GR DG  S A  +E  LP  +D++  +   F    +    ++AL  +H++G  HC K+  R++       VDP LN  +   +   CP+ + DP+
Sbjct:   76 ASVMIQSTPKNKAEKDHPDNISLAGDGFDVVIQAKKALDSNPSCRNKVSCADILTLATRDVVVAAGGPSYEVELGRFDGLVSTASSVEGNLPGPSDNVDKLNALFTKNKLTQEDMIALSAAHTLGFAHCGKVFKRIHKFNGINSVDPTLNKAYAIELQKACPKNV-DPR 243          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER1A_ARMRU (Peroxidase C1A OS=Armoracia rusticana GN=PRXC1A PE=1 SV=2)

HSP 1 Score: 82.4185 bits (202), Expect = 4.532e-15
Identity = 52/160 (32.50%), Postives = 83/160 (51.88%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKE-MDRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGID-APGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CP 460
            AS+LLD+T    +EK+    +   R F  I+ +K AVE  CP  VSCAD+L ++ +  V   GGP   +  GRRD  ++  ++    LP    ++  + + F  +G++ +  LVAL G H+ G+  C  ++ RLY        DP LN  ++  +   CP
Sbjct:   81 ASILLDNTTSFRTEKDAFGNANSARGFPVIDRMKAAVESACPRTVSCADLLTIAAQQSVTLAGGPSWRVPLGRRDSLQAFLDLANANLPAPFFTLPQLKDSFRNVGLNRSSDLVALSGGHTFGKNQCRFIMDRLYNFSNTGLPDPTLNTTYLQTLRGLCP 240          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER2_MAIZE (Peroxidase 2 OS=Zea mays GN=PER2 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 7.731e-15
Identity = 55/158 (34.81%), Postives = 84/158 (53.16%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEM--DRSFGMRNFRYIENIKEAVERECPGVVSCADILVLSGRDG--VVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLV-HRLYPEVDPALNPDHVPHMLP*CP 460
            AS+LLD T  + + +++    +  +R F  I+ IK+A+E  CPGVVSCADI+  + RD    ++ G     + +GR DG  S A    ++L     ++S +   FA  G+    LV L G+H+VGR+HC   V  RL  +V   +NP     +   CP
Sbjct:   84 ASVLLDPTPFSPTPEKLAAPNNPSLRGFELIDAIKDALEAACPGVVSCADIIAFAARDASCFLSQGKVSFDMPSGRLDGTFSNASESVKFLVPPTSNLSDLASSFAVKGMSLEDLVVLSGAHTVGRSHCSSFVSDRL--DVPSDINPALAAFLRTRCP 239          
BLAST of EY665198 vs. ExPASy Swiss-Prot
Match: PER73_ARATH (Peroxidase 73 OS=Arabidopsis thaliana GN=PER73 PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.010e-14
Identity = 66/222 (29.73%), Postives = 106/222 (47.75%), Query Frame = 2
Query:    2 ASLLLDSTRKTLSEKEMDRSFGMRN--FRYIENIKEAVER--ECPGVVSCADILVLSGRDGVVALGGPYIPLKTGRRDGRKSRAEILEQYLPDHNDSMSVVLERFAAIGIDAPGLVALLGSHSVGRTHCVKLVHRLY-----PEVDPALNPDHVPHMLP*CPECIPDPKAVQYVRNDRGTPLVLEQHLL*GTYWTTKGLIEVDLHLTPEQEEKTLLLKKWAK 640
            AS+++ ST    +EK+   +  +    F  +   K+A++    C   VSCADIL L+ RD VVA  GP   ++ GR DG  S A  +   LP  N+ ++ + + FA   +    ++AL  +H++G  HC K+ +R+Y       VDP LN  +   +   CP+ + DP+    +  D  TP   + ++        KGL   D  L  +   K   +  WAK
Sbjct:   76 ASVMIQSTPTNKAEKDHPDNISLAGDGFDVVIKAKKALDAIPSCKNKVSCADILALATRDVVVAAKGPSYAVELGRFDGLVSTAASVNGNLPGPNNKVTELNKLFAKNKLTQEDMIALSAAHTLGFAHCGKVFNRIYNFNLTHAVDPTLNKAYAKELQLACPKTV-DPRIA--INMDPTTPRQFD-NIYFKNLQQGKGLFTSDQVLFTDGRSKP-TVNDWAK 292          
The following BLAST results are available for this feature:
BLAST of EY665198 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 104
Match NameE-valueIdentityDescription
PER45_ARATH2.403e-1634.27Peroxidase 45 OS=Arabidopsis thaliana GN=PER45 PE=... [more]
PER44_ARATH2.403e-1638.46Peroxidase 44 OS=Arabidopsis thaliana GN=PER44 PE=... [more]
PER9_ARATH3.139e-1636.57Peroxidase 9 OS=Arabidopsis thaliana GN=PER9 PE=1 ... [more]
PER66_MAIZE5.354e-1637.23Peroxidase 66 OS=Zea mays GN=PER66 PE=1 SV=1[more]
PER12_ARATH9.132e-1632.94Peroxidase 12 OS=Arabidopsis thaliana GN=PER12 PE=... [more]
PER1_WHEAT2.657e-1535.61Peroxidase OS=Triticum aestivum PE=2 SV=1[more]
PER35_ARATH3.470e-1532.54Peroxidase 35 OS=Arabidopsis thaliana GN=PER35 PE=... [more]
PER1A_ARMRU4.532e-1532.50Peroxidase C1A OS=Armoracia rusticana GN=PRXC1A PE... [more]
PER2_MAIZE7.731e-1534.81Peroxidase 2 OS=Zea mays GN=PER2 PE=2 SV=1[more]
PER73_ARATH1.010e-1429.73Peroxidase 73 OS=Arabidopsis thaliana GN=PER73 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-083-B07-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665198 ID=EY665198|Name=EY665198|organism=Citrus sinensis|type=EST|length=1006bp
TGCTTCACTGCTTCTGGACTCGACTAGAAAGACCTTGTCTGAGAAGGAGA
TGGACAGGAGCTTTGGTATGAGGAACTTCAGGTACATTGAGAACATCAAA
GAAGCTGTTGAAAGAGAGTGCCCTGGTGTTGTTTCCTGTGCTGATATTCT
TGTCCTGTCCGGTAGAGATGGCGTTGTTGCGCTTGGAGGCCCTTACATTC
CTCTCAAGACAGGAAGAAGAGATGGTAGAAAAAGCAGAGCAGAGATACTT
GAGCAGTATCTCCCAGATCACAACGACAGCATGTCTGTTGTTCTTGAGAG
GTTTGCAGCCATTGGCATTGACGCCCCTGGACTTGTTGCTCTGCTAGGAT
CTCACAGTGTTGGCAGAACTCATTGTGTGAAGCTGGTGCACCGTCTGTAC
CCAGAAGTTGACCCTGCACTGAACCCTGACCATGTTCCGCATATGCTCCC
ATAATGTCCTGAATGCATCCCAGACCCCAAGGCTGTTCAGTATGTGAGGA
ATGACCGTGGCACCCCCCTGGTGCTGGAACAACACCTACTATAGGGAACT
TATTGGACAACAAAGGGCTTGATTGAGGTTGATCTTCACCTAACCCCCGA
ACAAGAGGAAAAGACCTTATTGTTAAAAAAATGGGCCAAAATCCAAGAAT
TAACTTCCTTAAGGGAATTTTCAAGAACCATTTCCCCTCCTTTTTGAAAA
AAACCCCTCTCCCAAGGTAAAAAGGGGGGAAATCCCAAAGGGTTGGGAAT
TTTTGCCCCAAAAAACCCCCCCAAAAAAATCCCAAAGTTATCTAAAAACA
CTTGTTTTTTTACTCCACAACAAAATTTAAATAACCCCCCCAATTTTTTC
TTTTCCCTTTGTTTTTTTTTCTCATAAAGAGAAAAAAAAAAAAAAAAGGG
GGGGGGAAATAAGCCCCCCTCCCCAAAAAAAAAAAAGGGGTTTTTTTTCT
TAAAAAAAATAAGGGTTGTTTTTGTTTCTCCCCCTCGCGGGGGAAAAGAG
AAGAGT
back to top