EY665182

Overview
NameEY665182
Unique NameEY665182
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1045
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: HAS1_PICST (ATP-dependent RNA helicase HAS1 OS=Pichia stipitis GN=HAS1 PE=3 SV=2)

HSP 1 Score: 185.652 bits (470), Expect = 3.993e-46
Identity = 91/161 (56.52%), Postives = 116/161 (72.05%), Query Frame = 1
Query:    1 EDLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQVDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFL 483
            EDLAR+S +  P+YI+V       T +GL+QGY V  S KRF+LL+SFLK+   KK++VF SSCNSVK+  ELL YI +   D+HGKQKQQKRT TFF+FC A++G L+CTDVAARGLDIPAVDWI+Q+DPPD+P++      VG        KG + +FL
Sbjct:  297 EDLARISLRPGPLYINVVPETAASTADGLEQGYVVCDSDKRFLLLFSFLKKYSKKKIIVFLSSCNSVKYFGELLNYIDLPVLDLHGKQKQQKRTNTFFEFCNAKQGTLVCTDVAARGLDIPAVDWIIQFDPPDDPRDYIHR--VGRTARGSNGKGKSLMFL 455          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: HAS1_ASPTN (ATP-dependent RNA helicase has1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=has1 PE=3 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 5.767e-45
Identity = 103/231 (44.59%), Postives = 147/231 (63.64%), Query Frame = 1
Query:    1 EDLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQVDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFLDSRKNLHFPSIF*RAGKNPLVKKIMNFE-PKKTGSKVQSPSGEKIGLANTYLILKPTPPKNGVTHFLFPY 690
            EDLAR+S +  P+YI+VD  +   T +G+ QGY +  + KRF+LL++FLK+NL KK+++FFSSCN+VK++++LL YI +    +HGK KQQ RT  FF+FC A +G L+CTDVAARGLDIPAVD+I+Q+DPPDEPK  Y      TA   KG  G + + L     + F ++  R  + P+V+    FE P+K    +QS   + IG    Y + +    K+G   +L  Y
Sbjct:  292 EDLARISLKPGPLYINVDHRKEHATVDGVDQGYIICEADKRFLLLFTFLKKNLKKKIIIFFSSCNAVKYYADLLNYIDLPVLALHGKLKQQTRTQRFFEFCNATQGTLICTDVAARGLDIPAVDYIIQFDPPDEPKA-YIHRVGRTARGTKGKIGRSIMLLQP-SEVGFLNVL-REARVPVVE----FEFPQKKIIDIQSQLEKLIG--QNYYLNQIQSAKDGYRAYLHAY 513          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: HAS1_PHANO (ATP-dependent RNA helicase HAS1 OS=Phaeosphaeria nodorum GN=HAS1 PE=3 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 9.836e-45
Identity = 90/161 (55.90%), Postives = 118/161 (73.29%), Query Frame = 1
Query:    1 EDLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQVDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFL 483
            EDLAR+S +  P+YI+VD  +   T EGL+QGY +  S  RF LL+SFLK++  KKV+VFFSSCNSVKF++ELL YI +   ++HGK KQQ RT  FF+FC A+ G L+CTDVAARGLDIP VDW++Q+DPPD+P++ Y      TA   +G KG + +FL
Sbjct:  324 EDLARISLKAGPLYINVDYRKEHSTVEGLEQGYVICDSDTRFRLLFSFLKKHQKKKVIVFFSSCNSVKFYAELLNYIDLPVLELHGKLKQQARTNRFFEFCNAQSGTLICTDVAARGLDIPEVDWVIQFDPPDDPRD-YIHRVGRTARGSEG-KGRSLMFL 482          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: HAS1_USTMA (ATP-dependent RNA helicase HAS1 OS=Ustilago maydis GN=HAS1 PE=3 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 1.285e-44
Identity = 90/161 (55.90%), Postives = 117/161 (72.67%), Query Frame = 1
Query:    1 EDLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQVDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFL 483
            +DLAR+S +  P+YI+V       T   L+QGY V  S +RF+LL++FLK+N  KK++VF SSCNSVK+HS+LL +I V   D+HGKQKQQKRT TFF++C A  G LLCTDVAARGLDIP+VDWI+Q+DPPD+P++ Y      TA  + G  G + LFL
Sbjct:  244 QDLARISLRPGPLYINVHADLAASTVSRLEQGYVVCESDRRFLLLFTFLKKNAGKKIIVFMSSCNSVKYHSDLLNFIDVPVLDLHGKQKQQKRTNTFFEYCNAPCGTLLCTDVAARGLDIPSVDWIIQFDPPDDPRD-YIHRVGRTA--RAGNSGKSLLFL 401          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DDX10_DICDI (Probable ATP-dependent RNA helicase ddx10 OS=Dictyostelium discoideum GN=ddx10 PE=3 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 9.249e-27
Identity = 61/135 (45.19%), Postives = 83/135 (61.48%), Query Frame = 1
Query:    4 DLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDE 402
            DLARLS Q  P YI V +     T + L Q  CV+P   +  +L+SF+K +L+ K++VFF+SC  V+F  E  + +      F +HGK KQ  R   F DFCK + G L  TD+AARGLD PAV+W++Q D PD+
Sbjct:  334 DLARLSLQE-PEYISVYEKDITTTPQNLTQTLCVIPLEMKLNMLFSFIKTHLTSKIIVFFASCKQVRFAHETFKLLNPGTTLFPLHGKMKQWTRLEVFEDFCKKKAGTLFATDIAARGLDFPAVEWVIQVDCPDD 467          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DBP4_COCIM (ATP-dependent RNA helicase DBP4 OS=Coccidioides immitis GN=DBP4 PE=3 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 9.571e-24
Identity = 68/163 (41.72%), Postives = 92/163 (56.44%), Query Frame = 1
Query:    4 DLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFLD 486
            DLARLS +  P YI V +  +  T   LQQ Y V P  ++   L+SF++  L  K++VFFSS   V+F  E  R++Q  +    +HG+QKQ  R      F +A+   L  TDVAARGLD PAVDW++Q D P E  + Y      TA +++   G A LFLD
Sbjct:  241 DLARLSLRD-PEYISVHEAASSATPASLQQHYVVTPLPEKLDTLWSFIRNTLKSKILVFFSSSKQVRFVYEAFRHMQPGIPLLHLHGRQKQSARIDITSKFSRAKYSCLFSTDVAARGLDFPAVDWVIQLDCP-EDADTYIHRVGRTARYER--DGRAVLFLD 399          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DBP4_ASPCL (ATP-dependent RNA helicase dbp4 OS=Aspergillus clavatus GN=dbp4 PE=3 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 9.571e-24
Identity = 69/163 (42.33%), Postives = 94/163 (57.67%), Query Frame = 1
Query:    4 DLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFLD 486
            DLARLS +  P Y+ V +  +  T   LQQ Y + P  ++  +L+SF++ NL  K MVFFSS   V+F  E  R++Q  +    +HG+QKQ  R     +F +A+  +L  TDVAARGLD PAVDW++Q D P E  + Y      TA  + G  G A LFLD
Sbjct:  242 DLARLSLRD-PEYVAVHETASTATPAKLQQHYVIAPLPQKLDILWSFIRSNLKSKTMVFFSSGKQVRFVYESFRHMQPGIPLMHLHGRQKQGGRLDIMTNFSQAKHCVLFSTDVAARGLDFPAVDWVIQMDCP-EDADTYIHRVGRTA--RYGRDGRAVLFLD 400          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DBP4_SCLS1 (ATP-dependent RNA helicase dbp4 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp4 PE=3 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 2.132e-23
Identity = 67/163 (41.10%), Postives = 91/163 (55.83%), Query Frame = 1
Query:    4 DLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFLD 486
            DLARLS +  P Y+ V +  +  T   LQQ YCVVP  ++   L+ F++ NL  K++VF SS   V+F  E LR++Q  +    +HG+QKQ  R      F  ++   +  TDV ARGLD PAVDW++Q D P E  + Y      TA  + G  G A LFLD
Sbjct:  242 DLARLSLKE-PEYVAVHEAASSATPTTLQQHYCVVPLPEKLNTLFGFIRANLKAKIIVFMSSGKQVRFVYESLRHLQPGIPLLHLHGRQKQTARLDITSKFSSSKNSCIFATDVVARGLDFPAVDWVIQLDCP-EDADTYIHRVGRTA--RYGKVGRAVLFLD 400          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DBP4_ASPNC (ATP-dependent RNA helicase dbp4 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp4 PE=3 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 2.132e-23
Identity = 69/163 (42.33%), Postives = 92/163 (56.44%), Query Frame = 1
Query:    4 DLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFLD 486
            DLARLS Q  P Y+ V +  +  T   LQQ Y V P  ++  +L+SF++ NL  K +VF SS   V+F  E  R++Q  V    +HG+QKQ  R      F  A+  +L  TDVAARGLD PAVDW++Q D P E  + Y      TA +++   G A LFLD
Sbjct:  240 DLARLSLQD-PEYVAVHEAASSATPSKLQQHYVVTPLPQKLDVLWSFIRSNLKSKTIVFLSSGKQVRFVYESFRHMQPGVPLMHLHGRQKQGGRLDITTKFSSAQHAVLFATDVAARGLDFPAVDWVIQLDCP-EDADTYIHRVGRTARYER--DGRAVLFLD 398          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DBP4_SCHPO (ATP-dependent RNA helicase dbp4 OS=Schizosaccharomyces pombe GN=dbp4 PE=1 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 3.637e-23
Identity = 56/136 (41.18%), Postives = 79/136 (58.09%), Query Frame = 1
Query:    1 EDLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDE 402
            +DLARLS Q  P +I V +  T  T   L Q Y  VP  ++  +L+ F++ +L  K +VF SSC  V+F  E  R ++  +    +HGKQKQ  RT     F  +   +L CTD+ ARGLD PAVDW++Q D P++
Sbjct:  231 KDLARLSLQN-PDFISVHENDTSSTPSNLNQFYLTVPLTEKLDILFGFIRTHLKFKTIVFLSSCKQVRFVYETFRRMRPGISLLHLHGKQKQTTRTEVTAKFTSSRHVVLFCTDIVARGLDFPAVDWVIQLDAPED 365          
The following BLAST results are available for this feature:
BLAST of EY665182 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 129
Match NameE-valueIdentityDescription
HAS1_PICST3.993e-4656.52ATP-dependent RNA helicase HAS1 OS=Pichia stipitis... [more]
HAS1_ASPTN5.767e-4544.59ATP-dependent RNA helicase has1 OS=Aspergillus ter... [more]
HAS1_PHANO9.836e-4555.90ATP-dependent RNA helicase HAS1 OS=Phaeosphaeria n... [more]
HAS1_USTMA1.285e-4455.90ATP-dependent RNA helicase HAS1 OS=Ustilago maydis... [more]
DDX10_DICDI9.249e-2745.19Probable ATP-dependent RNA helicase ddx10 OS=Dicty... [more]
DBP4_COCIM9.571e-2441.72ATP-dependent RNA helicase DBP4 OS=Coccidioides im... [more]
DBP4_ASPCL9.571e-2442.33ATP-dependent RNA helicase dbp4 OS=Aspergillus cla... [more]
DBP4_SCLS12.132e-2341.10ATP-dependent RNA helicase dbp4 OS=Sclerotinia scl... [more]
DBP4_ASPNC2.132e-2342.33ATP-dependent RNA helicase dbp4 OS=Aspergillus nig... [more]
DBP4_SCHPO3.637e-2341.18ATP-dependent RNA helicase dbp4 OS=Schizosaccharom... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-083-A02-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665182 ID=EY665182|Name=EY665182|organism=Citrus sinensis|type=EST|length=1045bp
GAGGATCTTGCTCGCTTGTCATTTCAGACAACTCCAGTTTATATTGATGT
GGATGATGGGAGAACTAAGGTCACCAACGAAGGCCTGCAGCAAGGCTATT
GTGTGGTGCCCAGTGCCAAGAGATTTATCCTTCTATATTCCTTCTTGAAG
AGGAATCTGTCAAAGAAAGTGATGGTCTTCTTCTCCTCGTGTAATTCAGT
CAAATTTCATTCAGAACTTCTCAGATATATTCAGGTGGATTGCTTTGATA
TCCATGGAAAGCAAAAGCAACAGAAACGAACCACTACCTTCTTTGACTTC
TGCAAGGCGGAGAAGGGCATCTTGTTGTGTACTGATGTAGCTGCCCGTGG
ACTTGACATTCCTGCTGTGGACTGGATTGTGCAGTATGATCCTCCTGATG
AACCCAAGGAATAATATTCTTCGGGTGGGGTCGGGACAGCCCCGTGGAAG
AAAGGTGCAAAAGGAAATGCCCCACTTTTTCTTGATTCCAGAAAGAATTT
ACATTTTCCTTCCATATTCTGAAGGGCTGGCAAAAATCCCCTGGTTAAAA
AAATTATGAATTTTGAACCAAAAAAAACTGGGTCTAAGGTGCAGTCCCCT
TCCGGGGAAAAAATTGGGTTGGCTAACACCTATTTAATTTTGAAACCAAC
CCCCCCTAAAAATGGCGTTACGCATTTTTTATTTCCATACCAATAGATTT
CCCCACCCCCTAAGAAAGAATAAATCTTCCAAGGTATACCCCCCCCTATT
GATTTGGAAGGGGGAACCCGCCCTCGTTTTTATTTATTGTTTTTTTTTCT
CCCCCCCCCCCTAGAGGGGGAAAAATCCAAACACATAGAAAACCACGCTG
GTCCCCTCTTATAATTTTTTAAAAAAATAAAAAACCACCCCAAAAAAACT
CACACAAAAGAGAACACAAAAACAAATTGGTTTTTTTCTCATTGAAAACA
CTCCACCCCCCTTTTTATTGGAGTGGTAGGAAACAGAAGAAAGAATAATA
AAAAATAAAAATAAAAATACACACCCCCCCCACTTTTGTTTTTAT
back to top