EY665182

Overview
NameEY665182
Unique NameEY665182
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1045
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DBP4_YEAST (ATP-dependent RNA helicase DBP4 OS=Saccharomyces cerevisiae GN=DBP4 PE=1 SV=2)

HSP 1 Score: 101.293 bits (251), Expect = 9.905e-21
Identity = 62/141 (43.97%), Postives = 85/141 (60.28%), Query Frame = 1
Query:    4 DLARLS---FQTTPVYIDVDDG---RTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDE 402
            DLARLS   ++T   + DV DG   +   T E LQQ Y  VP A +  +L+SF+K +L  K++VF SS   V F  E  R +Q  +    +HG+QKQ+ RT T   F +A++  L  TDV ARG+D PAVDW+VQ D P++
Sbjct:  234 DLARLSLTDYKTVGTH-DVMDGSVNKEASTPETLQQFYIEVPLADKLDILFSFIKSHLKCKMIVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQRARTETLDKFNRAQQVCLFATDVVARGIDFPAVDWVVQVDCPED 373          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DBP4_YEAS7 (ATP-dependent RNA helicase DBP4 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP4 PE=3 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 9.905e-21
Identity = 62/141 (43.97%), Postives = 85/141 (60.28%), Query Frame = 1
Query:    4 DLARLS---FQTTPVYIDVDDG---RTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDE 402
            DLARLS   ++T   + DV DG   +   T E LQQ Y  VP A +  +L+SF+K +L  K++VF SS   V F  E  R +Q  +    +HG+QKQ+ RT T   F +A++  L  TDV ARG+D PAVDW+VQ D P++
Sbjct:  234 DLARLSLTDYKTVGTH-DVMDGSVNKEASTPETLQQFYIEVPLADKLDILFSFIKSHLKCKMIVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQRARTETLDKFNRAQQVCLFATDVVARGIDFPAVDWVVQVDCPED 373          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DDX10_HUMAN (Probable ATP-dependent RNA helicase DDX10 OS=Homo sapiens GN=DDX10 PE=1 SV=2)

HSP 1 Score: 100.908 bits (250), Expect = 1.294e-20
Identity = 52/136 (38.24%), Postives = 83/136 (61.03%), Query Frame = 1
Query:    1 EDLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDE 402
            +DLARLS +  P Y+ V +     T   L+Q Y V    ++  +LYSFL+ +L KK +VFFSSC  V++   +   ++  V    +HG+Q+Q +R   + +F +    +L  TD+AARGLD PAV+W++Q+D P++
Sbjct:  261 KDLARLSLKN-PEYVWVHEKAKYSTPATLEQNYIVCELQQKISVLYSFLRSHLKKKSIVFFSSCKEVQYLYRVFCRLRPGVSILALHGRQQQMRRMEVYNEFVRKRAAVLFATDIAARGLDFPAVNWVLQFDCPED 395          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DBP4_CANGA (ATP-dependent RNA helicase DBP4 OS=Candida glabrata GN=DBP4 PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 1.294e-20
Identity = 56/136 (41.18%), Postives = 78/136 (57.35%), Query Frame = 1
Query:    4 DLARLSFQTTPVYIDVDDGRT-KVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDE 402
            DLARLS         +D       T + LQQ Y +   A +  +LYSF+K +L  K++VFFSS   V F  E  R +Q  +    +HG+QKQ+ RT T   F +A++  L  TDV ARG+D PAVDW++Q D P++
Sbjct:  234 DLARLSLTDYKKIGTIDSSEDGPATPKTLQQSYIIADLADKLDVLYSFIKSHLKTKMIVFFSSSKQVHFVYETFRKMQPGISLLHLHGRQKQRARTETLDKFFRAQQVCLFATDVVARGIDFPAVDWVIQVDCPED 369          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DBP4_CANAL (ATP-dependent RNA helicase DBP4 OS=Candida albicans GN=DBP4 PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 1.294e-20
Identity = 56/136 (41.18%), Postives = 79/136 (58.09%), Query Frame = 1
Query:    4 DLARLSFQTTPVYIDVD-DGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDE 402
            DLARLS  T P  I V  D     T E L+Q Y  VP  ++  +L+SF+K +L  K++VFFSS   V++  E  R +Q  +    ++G+ KQ  R  T   F +A+   L  TD+ ARGLD PA+DW+VQ D P++
Sbjct:  241 DLARLSL-TNPNKIGVSSDQEVSATPESLEQYYVKVPLDEKLDVLWSFIKSHLKSKILVFFSSSKQVQYTYETFRTLQPGISLMKLYGRHKQTSRLETTMKFSQAQHACLFATDIVARGLDFPAIDWVVQVDCPED 375          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DDX10_CHICK (Probable ATP-dependent RNA helicase DDX10 OS=Gallus gallus GN=DDX10 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.690e-20
Identity = 60/169 (35.50%), Postives = 92/169 (54.44%), Query Frame = 1
Query:    1 EDLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFLDSRKNL 501
            +DLARLS +  P Y+ V +     T   L Q Y V     +  +LYSFL+ +L KK +VFF+SC  V++   +   +Q  +    +HGKQ+Q KR   +  F + +  +L  TD+AARGLD PAV+W++Q+D P++    Y      TA +K+G +    L     K +
Sbjct:  265 KDLARLSLKD-PEYVWVHEKAKFSTPATLDQNYIVCELQHKINVLYSFLRSHLKKKSIVFFASCKEVQYLFRVFCKLQPGLPVLALHGKQQQMKRMEVYTCFVRKKAAVLFATDIAARGLDFPAVNWVIQFDCPEDANT-YIHRVGRTARYKEGGEALLVLLPSEEKGM 431          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DBP4_DEBHA (ATP-dependent RNA helicase DBP4 OS=Debaryomyces hansenii GN=DBP4 PE=3 SV=2)

HSP 1 Score: 99.3673 bits (246), Expect = 3.764e-20
Identity = 64/193 (33.16%), Postives = 95/193 (49.22%), Query Frame = 1
Query:    1 EDLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDEPKE*YSSGGVGTAPWKKGAKGNAPLFLDSRKNLHFPSIF*RAGKNPLVKKIMNFEPK 573
            +DLARLS           D     T E L+Q Y  +P  ++  +L+SF+K +L  K++VFFSS   V++  E  R +Q  +    ++G+ KQ  R  T   F +A+   L  TD+ ARGLD PA+DW+VQ D P++         VG A     A  +  + L S +N     +  R   N +  K MN + K
Sbjct:  238 KDLARLSLANPKRVGISSDQELSATPESLEQYYIKIPLDEKLDVLWSFIKSHLKSKILVFFSSSKQVQYAYETFRTLQPGISLLKLYGRHKQTSRMETTMKFSQAQHACLFATDIVARGLDFPAIDWVVQIDCPEDAATYVHR--VGRAARFGRAGKSLMMLLPSEEN----GMLKRLNNNKIELKFMNIKQK 424          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DBP4_PICST (ATP-dependent RNA helicase DBP4 OS=Pichia stipitis GN=DBP4 PE=3 SV=2)

HSP 1 Score: 98.5969 bits (244), Expect = 6.420e-20
Identity = 55/137 (40.15%), Postives = 79/137 (57.66%), Query Frame = 1
Query:    1 EDLARLSFQTTPVYIDVD-DGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDE 402
            +DLARLS  T P  I V  D     T E L Q Y  +P  ++  +L+SF+K +L  K++VFFSS   V++  E  R +Q  +    ++G+ KQ  R  T   F +A+   L  TD+ ARGLD PA+DW+VQ D P++
Sbjct:  239 KDLARLSL-TNPKRIGVSSDQDVSATPESLDQYYIRIPLDEKLDVLWSFIKSHLKSKILVFFSSSKQVQYAYETFRTLQPGISLLKLYGRHKQTSRLETTVKFTQAQYACLFATDIVARGLDFPAIDWVVQVDCPED 374          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DBP4_KLULA (ATP-dependent RNA helicase DBP4 OS=Kluyveromyces lactis GN=DBP4 PE=3 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 6.420e-20
Identity = 54/139 (38.85%), Postives = 79/139 (56.83%), Query Frame = 1
Query:    1 EDLARLS---FQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDE 402
            +DLARLS   ++       ++   +  T E LQQ Y  VP   +  +L+SF+K +L  K++VF SS   V F  E  R +Q  +    +HG+QKQ  RT T   F +A+   L  TDV ARG+D P+VDW++Q D P++
Sbjct:  233 DDLARLSLTDYKQVGTMEVLNANSSSATPESLQQSYIEVPLPDKLDILFSFIKSHLKSKLIVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQTARTETLDKFSRAQHVCLFSTDVVARGIDFPSVDWVIQVDCPED 371          
BLAST of EY665182 vs. ExPASy Swiss-Prot
Match: DDX10_MOUSE (Probable ATP-dependent RNA helicase DDX10 OS=Mus musculus GN=Ddx10 PE=1 SV=2)

HSP 1 Score: 97.8265 bits (242), Expect = 1.095e-19
Identity = 49/136 (36.03%), Postives = 83/136 (61.03%), Query Frame = 1
Query:    1 EDLARLSFQTTPVYIDVDDGRTKVTNEGLQQGYCVVPSAKRFILLYSFLKRNLSKKVMVFFSSCNSVKFHSELLRYIQ--VDCFDIHGKQKQQKRTTTFFDFCKAEKGILLCTDVAARGLDIPAVDWIVQYDPPDE 402
            +DLARLS +  P Y+ V +     T   L+Q Y +    ++  +L+SFL+ +L KK +VFFSSC  V++   +   ++  +    +HG+Q+Q +R   + +F +    +L  TD+AARGLD PAV+W++Q+D P++
Sbjct:  261 KDLARLSLKD-PEYVWVHEKAKYSTPATLEQNYIICELHQKISVLFSFLRSHLKKKSIVFFSSCKEVQYLYRVFCRLRPGISILALHGRQQQMRRMEVYNEFVRKRAAVLFATDIAARGLDFPAVNWVLQFDCPED 395          
The following BLAST results are available for this feature:
BLAST of EY665182 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 129
Match NameE-valueIdentityDescription
DBP4_YEAST9.905e-2143.97ATP-dependent RNA helicase DBP4 OS=Saccharomyces c... [more]
DBP4_YEAS79.905e-2143.97ATP-dependent RNA helicase DBP4 OS=Saccharomyces c... [more]
DDX10_HUMAN1.294e-2038.24Probable ATP-dependent RNA helicase DDX10 OS=Homo ... [more]
DBP4_CANGA1.294e-2041.18ATP-dependent RNA helicase DBP4 OS=Candida glabrat... [more]
DBP4_CANAL1.294e-2041.18ATP-dependent RNA helicase DBP4 OS=Candida albican... [more]
DDX10_CHICK1.690e-2035.50Probable ATP-dependent RNA helicase DDX10 OS=Gallu... [more]
DBP4_DEBHA3.764e-2033.16ATP-dependent RNA helicase DBP4 OS=Debaryomyces ha... [more]
DBP4_PICST6.420e-2040.15ATP-dependent RNA helicase DBP4 OS=Pichia stipitis... [more]
DBP4_KLULA6.420e-2038.85ATP-dependent RNA helicase DBP4 OS=Kluyveromyces l... [more]
DDX10_MOUSE1.095e-1936.03Probable ATP-dependent RNA helicase DDX10 OS=Mus m... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-083-A02-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY665182 ID=EY665182|Name=EY665182|organism=Citrus sinensis|type=EST|length=1045bp
GAGGATCTTGCTCGCTTGTCATTTCAGACAACTCCAGTTTATATTGATGT
GGATGATGGGAGAACTAAGGTCACCAACGAAGGCCTGCAGCAAGGCTATT
GTGTGGTGCCCAGTGCCAAGAGATTTATCCTTCTATATTCCTTCTTGAAG
AGGAATCTGTCAAAGAAAGTGATGGTCTTCTTCTCCTCGTGTAATTCAGT
CAAATTTCATTCAGAACTTCTCAGATATATTCAGGTGGATTGCTTTGATA
TCCATGGAAAGCAAAAGCAACAGAAACGAACCACTACCTTCTTTGACTTC
TGCAAGGCGGAGAAGGGCATCTTGTTGTGTACTGATGTAGCTGCCCGTGG
ACTTGACATTCCTGCTGTGGACTGGATTGTGCAGTATGATCCTCCTGATG
AACCCAAGGAATAATATTCTTCGGGTGGGGTCGGGACAGCCCCGTGGAAG
AAAGGTGCAAAAGGAAATGCCCCACTTTTTCTTGATTCCAGAAAGAATTT
ACATTTTCCTTCCATATTCTGAAGGGCTGGCAAAAATCCCCTGGTTAAAA
AAATTATGAATTTTGAACCAAAAAAAACTGGGTCTAAGGTGCAGTCCCCT
TCCGGGGAAAAAATTGGGTTGGCTAACACCTATTTAATTTTGAAACCAAC
CCCCCCTAAAAATGGCGTTACGCATTTTTTATTTCCATACCAATAGATTT
CCCCACCCCCTAAGAAAGAATAAATCTTCCAAGGTATACCCCCCCCTATT
GATTTGGAAGGGGGAACCCGCCCTCGTTTTTATTTATTGTTTTTTTTTCT
CCCCCCCCCCCTAGAGGGGGAAAAATCCAAACACATAGAAAACCACGCTG
GTCCCCTCTTATAATTTTTTAAAAAAATAAAAAACCACCCCAAAAAAACT
CACACAAAAGAGAACACAAAAACAAATTGGTTTTTTTCTCATTGAAAACA
CTCCACCCCCCTTTTTATTGGAGTGGTAGGAAACAGAAGAAAGAATAATA
AAAAATAAAAATAAAAATACACACCCCCCCCACTTTTGTTTTTAT
back to top