EY665116
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY665116 vs. ExPASy Swiss-Prot
Match: CB4A_ARATH (Chlorophyll a-b binding protein CP29.1, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.1 PE=1 SV=1) HSP 1 Score: 77.411 bits (189), Expect = 1.182e-13 Identity = 39/65 (60.00%), Postives = 47/65 (72.31%), Query Frame = 3 Query: 27 LYPRGSF-DPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVHAIVTGKGPLENLADHLADPVN 218 LYP G F DPLGLA DPE A+L++ EIK+ RLAM + GF V A TGKGPL N A HL+DP++ Sbjct: 216 LYPGGKFFDPLGLAADPEKTAQLQLAEIKHARLAMVAFLGFAVQAAATGKGPLNNWATHLSDPLH 280
BLAST of EY665116 vs. ExPASy Swiss-Prot
Match: CB4B_ARATH (Chlorophyll a-b binding protein CP29.2, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.2 PE=1 SV=1) HSP 1 Score: 74.7146 bits (182), Expect = 7.662e-13 Identity = 38/65 (58.46%), Postives = 45/65 (69.23%), Query Frame = 3 Query: 27 LYPRGSF-DPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVHAIVTGKGPLENLADHLADPVN 218 LYP G F DPLGLA DP A+L++ EIK+ RLAM GF V A TGKGPL N A HL+DP++ Sbjct: 213 LYPGGKFFDPLGLASDPVKKAQLQLAEIKHARLAMVGFLGFAVQAAATGKGPLNNWATHLSDPLH 277
BLAST of EY665116 vs. ExPASy Swiss-Prot
Match: CB24_ARATH (Chlorophyll a-b binding protein 4, chloroplastic OS=Arabidopsis thaliana GN=CAB4 PE=1 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 7.171e-11 Identity = 39/73 (53.42%), Postives = 44/73 (60.27%), Query Frame = 3 Query: 3 PLGEVTDPLYPRGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVHAIVTGKGPLENLADHLADPVNN 221 P GEV YP G F+PL A EA K KE+ NGRLAM + GF V VTGKGP ENL HL+DP +N Sbjct: 179 PKGEVG---YPGGIFNPLNFAPTQEA----KEKELANGRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHN 244 The following BLAST results are available for this feature:
BLAST of EY665116 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 73
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY665116 ID=EY665116; Name=EY665116; organism=Citrus sinensis; type=EST; length=879bpback to top |