EY665004
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY665004 vs. ExPASy Swiss-Prot
Match: ENO11_SCHPO (Enolase 1-1 OS=Schizosaccharomyces pombe GN=eno101 PE=1 SV=2) HSP 1 Score: 80.4925 bits (197), Expect = 4.265e-15 Identity = 37/48 (77.08%), Postives = 44/48 (91.67%), Query Frame = 2 Query: 35 TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGA 178 TFI+ L+VG+ GQ+K+GAPCRSERLAKYN+LLRIEEELG+E VYAGA Sbjct: 381 TFISHLTVGIGAGQLKSGAPCRSERLAKYNELLRIEEELGSEGVYAGA 428
BLAST of EY665004 vs. ExPASy Swiss-Prot
Match: ENO_YARLI (Enolase OS=Yarrowia lipolytica GN=ENO PE=3 SV=1) HSP 1 Score: 79.337 bits (194), Expect = 5.319e-15 Identity = 39/48 (81.25%), Postives = 43/48 (89.58%), Query Frame = 2 Query: 41 IADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKF 184 IADL+VGL GQIKTGAP RSERLAKYNQLLRIEEELG +A++AG KF Sbjct: 385 IADLAVGLRAGQIKTGAPSRSERLAKYNQLLRIEEELGDKAIFAGPKF 432 HSP 2 Score: 21.557 bits (44), Expect = 5.319e-15 Identity = 7/11 (63.64%), Postives = 11/11 (100.00%), Query Frame = 3 Query: 12 HRSGETEELSL 44 HRSGETE++++ Sbjct: 375 HRSGETEDVTI 385
BLAST of EY665004 vs. ExPASy Swiss-Prot
Match: ENO_EMENI (Enolase OS=Emericella nidulans GN=enoA PE=1 SV=1) HSP 1 Score: 79.337 bits (194), Expect = 5.319e-15 Identity = 40/52 (76.92%), Postives = 43/52 (82.69%), Query Frame = 2 Query: 41 IADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPV 196 IAD+SVGL +GQIKTGAP RSERLAK NQ+LRIEEELG AVYAG FR V Sbjct: 385 IADISVGLRSGQIKTGAPARSERLAKLNQILRIEEELGENAVYAGQNFRKSV 436 HSP 2 Score: 21.557 bits (44), Expect = 5.319e-15 Identity = 7/11 (63.64%), Postives = 11/11 (100.00%), Query Frame = 3 Query: 12 HRSGETEELSL 44 HRSGETE++++ Sbjct: 375 HRSGETEDVTI 385
BLAST of EY665004 vs. ExPASy Swiss-Prot
Match: ENO1_YEAST (Enolase 1 OS=Saccharomyces cerevisiae GN=ENO1 PE=1 SV=2) HSP 1 Score: 79.7221 bits (195), Expect = 7.276e-15 Identity = 41/50 (82.00%), Postives = 42/50 (84.00%), Query Frame = 2 Query: 35 TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKF 184 TFIADL VGL TGQIKTGAP RSERLAK NQLLRIEEELG AV+AG F Sbjct: 382 TFIADLVVGLRTGQIKTGAPARSERLAKLNQLLRIEEELGDNAVFAGENF 431
BLAST of EY665004 vs. ExPASy Swiss-Prot
Match: ENO_MASBA (Enolase OS=Mastigamoeba balamuthi GN=ENOL PE=2 SV=1) HSP 1 Score: 79.337 bits (194), Expect = 9.502e-15 Identity = 40/45 (88.89%), Postives = 40/45 (88.89%), Query Frame = 2 Query: 38 FIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYA 172 FIADL VGL GQIKTGAPCRSERLAKYNQLLRIEEELGA A YA Sbjct: 386 FIADLVVGLGCGQIKTGAPCRSERLAKYNQLLRIEEELGANAHYA 430
BLAST of EY665004 vs. ExPASy Swiss-Prot
Match: ENO_PENCI (Enolase OS=Penicillium citrinum GN=enoA PE=1 SV=3) HSP 1 Score: 78.1814 bits (191), Expect = 1.167e-14 Identity = 38/52 (73.08%), Postives = 43/52 (82.69%), Query Frame = 2 Query: 41 IADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPV 196 IAD++VGL +GQIKTGAP RSERLAK NQ+LRIEEELG A+YAG FR V Sbjct: 385 IADIAVGLRSGQIKTGAPARSERLAKLNQILRIEEELGENAIYAGKNFRTSV 436 HSP 2 Score: 21.557 bits (44), Expect = 1.167e-14 Identity = 7/11 (63.64%), Postives = 11/11 (100.00%), Query Frame = 3 Query: 12 HRSGETEELSL 44 HRSGETE++++ Sbjct: 375 HRSGETEDVTI 385
BLAST of EY665004 vs. ExPASy Swiss-Prot
Match: ENO_RHORB (Enolase OS=Rhodotorula rubra GN=ENO PE=1 SV=1) HSP 1 Score: 78.1814 bits (191), Expect = 2.117e-14 Identity = 38/50 (76.00%), Postives = 43/50 (86.00%), Query Frame = 2 Query: 35 TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKF 184 TFIADLSVG+ +GQ KTGAP RSERLAK NQ+LRIEEELG +A+YAG F Sbjct: 384 TFIADLSVGIRSGQTKTGAPARSERLAKLNQILRIEEELGDKAIYAGKDF 433
BLAST of EY665004 vs. ExPASy Swiss-Prot
Match: ENO_PLAYO (Enolase OS=Plasmodium yoelii yoelii GN=ENO PE=3 SV=2) HSP 1 Score: 77.7962 bits (190), Expect = 2.765e-14 Identity = 39/50 (78.00%), Postives = 40/50 (80.00%), Query Frame = 2 Query: 38 FIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFR 187 FIADL V L TGQIKTGAPCRSER AKYNQL RIEE LGA +AG KFR Sbjct: 391 FIADLVVALRTGQIKTGAPCRSERNAKYNQLFRIEESLGANGSFAGDKFR 440
BLAST of EY665004 vs. ExPASy Swiss-Prot
Match: ENO_ALTAL (Enolase OS=Alternaria alternata GN=ENO PE=1 SV=2) HSP 1 Score: 76.6406 bits (187), Expect = 3.325e-14 Identity = 39/52 (75.00%), Postives = 42/52 (80.77%), Query Frame = 2 Query: 41 IADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPV 196 IAD+ VGL +GQIKTGAP RSERLAK NQ+LRIEEELG AVYAG FR V Sbjct: 385 IADIVVGLRSGQIKTGAPARSERLAKLNQILRIEEELGDNAVYAGNNFRTAV 436 HSP 2 Score: 21.557 bits (44), Expect = 3.325e-14 Identity = 7/11 (63.64%), Postives = 11/11 (100.00%), Query Frame = 3 Query: 12 HRSGETEELSL 44 HRSGETE++++ Sbjct: 375 HRSGETEDVTI 385
BLAST of EY665004 vs. ExPASy Swiss-Prot
Match: ENO1_METHJ (Enolase 1 OS=Methanospirillum hungatei (strain JF-1 / DSM 864) GN=eno1 PE=3 SV=1) HSP 1 Score: 77.411 bits (189), Expect = 3.611e-14 Identity = 36/49 (73.47%), Postives = 41/49 (83.67%), Query Frame = 2 Query: 35 TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAK 181 +FIADL+V L TGQIKTGAPCR ER+ KYNQL+RI EELG+ A YAG K Sbjct: 372 SFIADLTVSLGTGQIKTGAPCRGERVEKYNQLMRIHEELGSRATYAGKK 420 The following BLAST results are available for this feature:
BLAST of EY665004 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 253
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY665004 ID=EY665004; Name=EY665004; organism=Citrus sinensis; type=EST; length=482bpback to top |