EY664660
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACT1_DAUCA (Actin-1 OS=Daucus carota PE=2 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 1.036e-11 Identity = 32/34 (94.12%), Postives = 33/34 (97.06%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKC 108 + GSILASLSTFQQMWISKGEYDESGPSIVHRKC Sbjct: 343 IGGSILASLSTFQQMWISKGEYDESGPSIVHRKC 376
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: POTEE_HUMAN (POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3) HSP 1 Score: 69.707 bits (169), Expect = 1.353e-11 Identity = 33/35 (94.29%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 V GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 1041 VGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 1075
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTBM_HUMAN (Beta-actin-like protein 3 OS=Homo sapiens GN=ACTBL3 PE=1 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 1.353e-11 Identity = 33/35 (94.29%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 V GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 341 VGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACT_PUCGR (Actin OS=Puccinia graminis PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 341 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACT_PLAMG (Actin, adductor muscle OS=Placopecten magellanicus PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 342 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACT_NEUCR (Actin OS=Neurospora crassa GN=act-1 PE=3 SV=2) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 341 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACT_LUMRU (Actin (Fragment) OS=Lumbricus rubellus PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 338 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 372
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACT_HYDAT (Actin, non-muscle 6.2 OS=Hydra attenuata PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 342 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACT_GAEGA (Actin OS=Gaeumannomyces graminis var. avenae GN=ACT PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 341 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACT_EXODE (Actin OS=Exophiala dermatitidis PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 341 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 The following BLAST results are available for this feature:
BLAST of EY664660 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 246
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY664660 ID=EY664660; Name=EY664660; organism=Citrus sinensis; type=EST; length=622bpback to top |