EY664660
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACT_ACHBI (Actin OS=Achlya bisexualis PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 2.308e-11 Identity = 31/35 (88.57%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSIL+SLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 342 IGGSILSSLSTFQQMWISKAEYDESGPSIVHRKCF 376
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACT6_SOLTU (Actin-71 OS=Solanum tuberosum GN=AC71 PE=3 SV=2) HSP 1 Score: 68.9366 bits (167), Expect = 2.308e-11 Identity = 31/35 (88.57%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 343 IGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACT4_ARATH (Actin-4 OS=Arabidopsis thaliana GN=ACT4 PE=1 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 2.308e-11 Identity = 31/35 (88.57%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 343 IGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACT3_SOLTU (Actin-58 OS=Solanum tuberosum GN=AC58 PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 2.308e-11 Identity = 31/35 (88.57%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 343 IGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACT3_PEA (Actin-3 OS=Pisum sativum PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 2.308e-11 Identity = 31/35 (88.57%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 343 IGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACT23_DICDI (Putative actin-23 OS=Dictyostelium discoideum GN=act23 PE=1 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 2.308e-11 Identity = 32/33 (96.97%), Postives = 32/33 (96.97%), Query Frame = 1 Query: 13 GSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 326 GSILASLSTFQQMWISKEEYDESGPSIVHRKCF 358
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACT1_TOBAC (Actin OS=Nicotiana tabacum PE=3 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 2.308e-11 Identity = 31/35 (88.57%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 343 IGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACT1_SORBI (Actin-1 OS=Sorghum bicolor GN=AC1 PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 2.308e-11 Identity = 31/35 (88.57%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 343 IGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACT1_ORYSJ (Actin-1 OS=Oryza sativa subsp. japonica GN=ACT1 PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 2.308e-11 Identity = 31/35 (88.57%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 343 IGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACT1_ORYSI (Actin-1 OS=Oryza sativa subsp. indica GN=ACT1 PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 2.308e-11 Identity = 31/35 (88.57%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 343 IGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF 377 The following BLAST results are available for this feature:
BLAST of EY664660 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 246
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY664660 ID=EY664660; Name=EY664660; organism=Citrus sinensis; type=EST; length=622bpback to top |