EY664660
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTH_RAT (Actin, gamma-enteric smooth muscle OS=Rattus norvegicus GN=Actg2 PE=2 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.937e-11 Identity = 31/35 (88.57%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 342 IGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF 376
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTH_MOUSE (Actin, gamma-enteric smooth muscle OS=Mus musculus GN=Actg2 PE=2 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.937e-11 Identity = 31/35 (88.57%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 342 IGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF 376
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTH_HUMAN (Actin, gamma-enteric smooth muscle OS=Homo sapiens GN=ACTG2 PE=1 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.937e-11 Identity = 31/35 (88.57%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 342 IGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF 376
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTH_CHICK (Actin, gamma-enteric smooth muscle OS=Gallus gallus GN=ACTG2 PE=2 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.937e-11 Identity = 31/35 (88.57%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 342 IGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF 376
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTH_BOVIN (Actin, gamma-enteric smooth muscle OS=Bos taurus GN=ACTG2 PE=2 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.937e-11 Identity = 31/35 (88.57%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 342 IGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF 376
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTC_XENLA (Actin, alpha cardiac muscle 1 OS=Xenopus laevis GN=actc1 PE=2 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.937e-11 Identity = 31/35 (88.57%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 343 IGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTC_TAKRU (Actin, alpha cardiac OS=Takifugu rubripes PE=2 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.937e-11 Identity = 31/35 (88.57%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 343 IGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTC_RAT (Actin, alpha cardiac muscle 1 OS=Rattus norvegicus GN=Actc1 PE=1 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.937e-11 Identity = 31/35 (88.57%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 343 IGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTC_MOUSE (Actin, alpha cardiac muscle 1 OS=Mus musculus GN=Actc1 PE=1 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.937e-11 Identity = 31/35 (88.57%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 343 IGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTC_HUMAN (Actin, alpha cardiac muscle 1 OS=Homo sapiens GN=ACTC1 PE=1 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.937e-11 Identity = 31/35 (88.57%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDE+GPSIVHRKCF Sbjct: 343 IGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377 The following BLAST results are available for this feature:
BLAST of EY664660 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 246
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY664660 ID=EY664660; Name=EY664660; organism=Citrus sinensis; type=EST; length=622bpback to top |