EY664660
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACT1_PLAFX (Actin-1 OS=Plasmodium falciparum (isolate HB3) PE=1 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 8.770e-11 Identity = 30/35 (85.71%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSIL+SLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 342 IGGSILSSLSTFQQMWITKEEYDESGPSIVHRKCF 376
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACT1_PLAFO (Actin-1 OS=Plasmodium falciparum (isolate NF54) PE=2 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 8.770e-11 Identity = 30/35 (85.71%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSIL+SLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 342 IGGSILSSLSTFQQMWITKEEYDESGPSIVHRKCF 376
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACT1_PLAF7 (Actin-1 OS=Plasmodium falciparum (isolate 3D7) GN=PFL2215w PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 8.770e-11 Identity = 30/35 (85.71%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSIL+SLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 342 IGGSILSSLSTFQQMWITKEEYDESGPSIVHRKCF 376
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACT1_PLABA (Actin-1 OS=Plasmodium berghei (strain Anka) GN=PB000323.01.0 PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 8.770e-11 Identity = 30/35 (85.71%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSIL+SLSTFQQMWI+K EYDESGPSIVHRKCF Sbjct: 341 IGGSILSSLSTFQQMWITKEEYDESGPSIVHRKCF 375
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACT1_HALRO (Actin, muscle 1A OS=Halocynthia roretzi GN=MA1A PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 8.770e-11 Identity = 30/35 (85.71%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWI+K EYDE+GPSIVHRKCF Sbjct: 344 IGGSILASLSTFQQMWITKQEYDEAGPSIVHRKCF 378
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACT17_DICDI (Actin-17 OS=Dictyostelium discoideum GN=act17 PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 8.770e-11 Identity = 30/35 (85.71%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GS+L+SLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 340 IGGSMLSSLSTFQQMWISKEEYDESGPSIVHRKCF 374 The following BLAST results are available for this feature:
BLAST of EY664660 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 246
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY664660 ID=EY664660; Name=EY664660; organism=Citrus sinensis; type=EST; length=622bpback to top |