EY664660
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTC_HELTI (Actin, cytoplasmic OS=Helisoma trivolvis PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 342 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTC_HALRO (Actin, nonmuscle OS=Halocynthia roretzi GN=CA1 PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 342 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTC_BRALA (Actin, cytoplasmic OS=Branchiostoma lanceolatum PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 341 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTC_BRAFL (Actin, cytoplasmic OS=Branchiostoma floridae PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 341 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTC_BRABE (Actin, cytoplasmic OS=Branchiostoma belcheri PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 341 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTC_BIOTE (Actin, cytoplasmic OS=Biomphalaria tenagophila PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 342 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTC_BIOPF (Actin, cytoplasmic OS=Biomphalaria pfeifferi PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 342 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTC_BIOOB (Actin, cytoplasmic OS=Biomphalaria obstructa PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 342 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTC_BIOGL (Actin, cytoplasmic OS=Biomphalaria glabrata PE=2 SV=2) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 342 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTC_BIOAL (Actin, cytoplasmic OS=Biomphalaria alexandrina PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 342 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 The following BLAST results are available for this feature:
BLAST of EY664660 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 246
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY664660 ID=EY664660; Name=EY664660; organism=Citrus sinensis; type=EST; length=622bpback to top |