EY664660
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTB_PONAB (Actin, cytoplasmic 1 OS=Pongo abelii GN=ACTB PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 341 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTB_PIG (Actin, cytoplasmic 1 OS=Sus scrofa GN=ACTB PE=2 SV=2) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 341 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTB_PANTR (Actin, cytoplasmic 1 OS=Pan troglodytes GN=ACTB PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 341 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTB_ORYLA (Actin, cytoplasmic 1 OS=Oryzias latipes GN=actb PE=2 SV=2) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 341 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTB_OREMO (Actin, cytoplasmic 1 OS=Oreochromis mossambicus GN=actb PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 341 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTB_MOUSE (Actin, cytoplasmic 1 OS=Mus musculus GN=Actb PE=1 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 341 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTB_MESAU (Actin, cytoplasmic 1 OS=Mesocricetus auratus GN=ACTB PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 341 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTB_MACFA (Actin, cytoplasmic 1 OS=Macaca fascicularis GN=ACTB PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 341 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTB_HUMAN (Actin, cytoplasmic 1 OS=Homo sapiens GN=ACTB PE=1 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 341 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTB_HORSE (Actin, cytoplasmic 1 OS=Equus caballus GN=ACTB PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 341 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 The following BLAST results are available for this feature:
BLAST of EY664660 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 246
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY664660 ID=EY664660; Name=EY664660; organism=Citrus sinensis; type=EST; length=622bpback to top |