EY664660
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTB_CYPCA (Actin, cytoplasmic 1 OS=Cyprinus carpio GN=actb PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 341 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTB_CTEID (Actin, cytoplasmic 1 OS=Ctenopharyngodon idella GN=actb PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 341 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTB_CHICK (Actin, cytoplasmic 1 OS=Gallus gallus GN=ACTB PE=1 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 341 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTB_CERPY (Actin, cytoplasmic 1 OS=Cercopithecus pygerythrus GN=ACTB PE=1 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 327 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 361
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTB_CERAE (Actin, cytoplasmic 1 OS=Cercopithecus aethiops GN=ACTB PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 341 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTB_CAVPO (Actin, cytoplasmic 1 OS=Cavia porcellus GN=ACTB PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 341 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTB_CANFA (Actin, cytoplasmic 1 OS=Canis familiaris GN=ACTB PE=2 SV=3) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 341 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTB_CAMDR (Actin, cytoplasmic 1 OS=Camelus dromedarius GN=ACTB PE=1 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 341 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTB_BOVIN (Actin, cytoplasmic 1 OS=Bos taurus GN=ACTB PE=1 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 341 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375
BLAST of EY664660 vs. ExPASy Swiss-Prot
Match: ACTB_BOSMU (Actin, cytoplasmic 1 OS=Bos mutus grunniens GN=ACTB PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.767e-11 Identity = 32/35 (91.43%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 7 VRGSILASLSTFQQMWISKGEYDESGPSIVHRKCF 111 + GSILASLSTFQQMWISK EYDESGPSIVHRKCF Sbjct: 341 IGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 The following BLAST results are available for this feature:
BLAST of EY664660 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 246
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY664660 ID=EY664660; Name=EY664660; organism=Citrus sinensis; type=EST; length=622bpback to top |