CX671778
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX671778 vs. ExPASy Swiss-Prot
Match: Y1570_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g05700 OS=Arabidopsis thaliana GN=At1g05700 PE=2 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 6.927e-11 Identity = 35/78 (44.87%), Postives = 47/78 (60.26%), Query Frame = -2 Query: 401 LSGLDLSCNKLIGHIPPQIGNLTRIQTLNLSHNNLTGSIPSTFSNLKHVESLDLSNNKLNGKIPHQLVELKTLEVFSV 634 ++ L+LS + L GHI NLT IQ L+LS+N LTG IP S LK + L+L NN L G +P +L+E FS+ Sbjct: 411 ITSLNLSSSGLTGHISSSFSNLTMIQELDLSNNGLTGDIPEFLSKLKFLRVLNLENNTLTGSVPSELLERSNTGSFSL 488
BLAST of CX671778 vs. ExPASy Swiss-Prot
Match: Y1561_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g56130 OS=Arabidopsis thaliana GN=At1g56130 PE=1 SV=2) HSP 1 Score: 68.1662 bits (165), Expect = 6.927e-11 Identity = 39/95 (41.05%), Postives = 54/95 (56.84%), Query Frame = -2 Query: 365 KVLSLLSGLDLSCNKLIGHIPPQIGNLTRIQTLNLSHNNLTGSIPSTFSNLKHVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEW 649 K + LS L L N L G IP IG + ++ ++LS N L G IP++ NL + L L NN LNG P Q + ++L V+YN+LSG +P W Sbjct: 288 KDMKSLSVLVLRNNNLTGTIPSTIGEHSSLRQVDLSFNKLHGPIPASLFNLSQLTHLFLGNNTLNGSFPTQ--KTQSLRNVDVSYNDLSGSLPSW 380 The following BLAST results are available for this feature:
BLAST of CX671778 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 92
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX671778 ID=CX671778; Name=CX671778; organism=Citrus sinensis; type=EST; length=860bpback to top |