CX671278

Overview
NameCX671278
Unique NameCX671278
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length716
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9540 contig Csv1_Contig9540:67..782. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB2A_SPIOL (Chlorophyll a-b binding protein, chloroplastic OS=Spinacia oleracea PE=1 SV=1)

HSP 1 Score: 402.519 bits (1033), Expect = 1.140e-111
Identity = 193/217 (88.94%), Postives = 201/217 (92.63%), Query Frame = 2
Query:   71 GKAVNLAPSGNELSNGGRISMRKTGSK--SVSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            GKAV L P+ +E+   GRI+MRKT  K  +V S SPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLADDPEAFAELK KEIKNGRLAMFSMFGFFV
Sbjct:   15 GKAVKLGPTASEIIGEGRITMRKTAGKPKTVQSSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFV 231          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB23_SOYBN (Chlorophyll a-b binding protein 3, chloroplastic OS=Glycine max GN=CAB3 PE=3 SV=1)

HSP 1 Score: 401.749 bits (1031), Expect = 1.944e-111
Identity = 194/215 (90.23%), Postives = 202/215 (93.95%), Query Frame = 2
Query:   71 GKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            GKAV L PS  E+   GR+SMRKT +K VSSGSPWYGPDRVKYLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGEVTDP+YPGGSFDPLGLADDPEAFAELK KE+KNGRLAMFSMFGFFV
Sbjct:   16 GKAVKLGPSAPEV---GRVSMRKTVTKQVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFV 227          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB24_PETSP (Chlorophyll a-b binding protein 25, chloroplastic OS=Petunia sp. GN=CAB25 PE=3 SV=1)

HSP 1 Score: 401.364 bits (1030), Expect = 2.539e-111
Identity = 193/219 (88.13%), Postives = 205/219 (93.61%), Query Frame = 2
Query:   65 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            F GKAVN+ PS ++++  G+ +MRKT +K+  VSSGSPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL ARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLADDPEAFAELK KEIKNGRLAMFSMFGFFV
Sbjct:   13 FAGKAVNV-PSSSQITGNGKATMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVIDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFV 230          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB23_NICPL (Chlorophyll a-b binding protein C, chloroplastic OS=Nicotiana plumbaginifolia GN=CABC PE=3 SV=1)

HSP 1 Score: 400.593 bits (1028), Expect = 4.331e-111
Identity = 190/219 (86.76%), Postives = 204/219 (93.15%), Query Frame = 2
Query:   65 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            F GKAV L+PS +E++  G+++MRKT SK+  VSS SPWYGP+RVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFK G+QIFS+GGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AG PLGEV DPLYPGGSFDPLGLA+DPEAFAELK KEIKNGRLAMFSMFGFFV
Sbjct:   13 FAGKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSSSPWYGPNRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKGGSQIFSQGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGEPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFV 231          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB23_PETSP (Chlorophyll a-b binding protein 22R, chloroplastic OS=Petunia sp. GN=CAB22R PE=3 SV=1)

HSP 1 Score: 397.897 bits (1021), Expect = 2.807e-110
Identity = 189/219 (86.30%), Postives = 202/219 (92.24%), Query Frame = 2
Query:   65 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            F GKAV L+ S +E++  G+++MRKT +K+   SS SPWYGPDRVKYLGP SGE PSYLTGEFP DYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL ARNG+KFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLA+DPEAFAELK KEIKNGRLAMFSMFGFFV
Sbjct:   13 FAGKAVKLSSSSSEITGNGKVTMRKTVTKAKPASSSSPWYGPDRVKYLGPFSGEAPSYLTGEFPSDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFARNGIKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVIDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFV 231          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB22_PETSP (Chlorophyll a-b binding protein 22L, chloroplastic OS=Petunia sp. GN=CAB22L PE=3 SV=1)

HSP 1 Score: 396.356 bits (1017), Expect = 8.168e-110
Identity = 187/219 (85.39%), Postives = 201/219 (91.78%), Query Frame = 2
Query:   65 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            F GK V L+PS +E++  G+ +MRKT +K+  VSSGSPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL ARNGVKFGEAVW KAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLG V DPLYPGGSFDPLGLA+DPEAFAELK KE KNGRLAMFSMFGFF+
Sbjct:   13 FAGKVVKLSPSSSEITGNGKATMRKTATKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFARNGVKFGEAVWLKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVLLMGAVEGYRVAGGPLGVVVDPLYPGGSFDPLGLAEDPEAFAELKVKETKNGRLAMFSMFGFFI 231          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB21_PETSP (Chlorophyll a-b binding protein 13, chloroplastic OS=Petunia sp. GN=CAB13 PE=3 SV=1)

HSP 1 Score: 395.586 bits (1015), Expect = 1.393e-109
Identity = 189/219 (86.30%), Postives = 203/219 (92.69%), Query Frame = 2
Query:   65 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            F GKAVN+ PS +E++  G+++MRKT +K+  VSSGSPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADP TFAKNR+LEVIHCRW MLGALGCVFPEL ARNGVKFGEAVWFKAG+QIF EGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLADDPEAFAEL+ KEIKNGRLAMFSMFGFFV
Sbjct:   13 FAGKAVNV-PSSSEITRNGKVTMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPATFAKNRKLEVIHCRWTMLGALGCVFPELFARNGVKFGEAVWFKAGSQIFKEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVIDPLYPGGSFDPLGLADDPEAFAELEVKEIKNGRLAMFSMFGFFV 230          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB29_MAIZE (Chlorophyll a-b binding protein M9, chloroplastic OS=Zea mays GN=CAB-M9 PE=2 SV=1)

HSP 1 Score: 390.193 bits (1001), Expect = 5.854e-108
Identity = 189/220 (85.91%), Postives = 201/220 (91.36%), Query Frame = 2
Query:   65 FVGKAVNLAPSGNELSNGGRISMRKTGSKS---VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            F GKAVN+  S   L    R++MRKT +K+    SSGSPWYGPDRV YLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGA+EGYR+AGGPLGEV DPLYPGG+FDPLGLADDPEAFA++K KE+KNGRLAMFSMFGFFV
Sbjct:   13 FAGKAVNVPSS---LFGEARVTMRKTAAKAKPAASSGSPWYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAIEGYRVAGGPLGEVVDPLYPGGTFDPLGLADDPEAFADVKVKELKNGRLAMFSMFGFFV 229          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB22_MAIZE (Chlorophyll a-b binding protein, chloroplastic OS=Zea mays PE=2 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 9.985e-108
Identity = 190/220 (86.36%), Postives = 198/220 (90.00%), Query Frame = 2
Query:   65 FVGKAVNLAPSGNELSNGGRISMRKTGSKS---VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            F GKAVN+  S        R++MRKT +K+    +SGSPWYGPDRV YLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLADDPEAF ELK KE+K GRLAM SMFGFFV
Sbjct:   13 FAGKAVNVPSSS---FGEARVTMRKTAAKAKPAAASGSPWYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFGELKVKELKKGRLAMLSMFGFFV 229          
BLAST of CX671278 vs. ExPASy Swiss-Prot
Match: CB21_SOYBN (Chlorophyll a-b binding protein, chloroplastic (Fragment) OS=Glycine max PE=2 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 9.985e-108
Identity = 186/199 (93.47%), Postives = 191/199 (95.98%), Query Frame = 2
Query:  119 GRISMRKTGSKSVSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKGKEIKNGRLAMFSMFGFFV 715
            GR+SMRKT SK+VSSGSPWYGPDRVKYLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELLARNGVKFGEA WFKAG+QIFSEGGLDYLGN SLIHAQSILAIWA QV+LMGAVEGYRIAGGPLGEVTDP+YPGGSFDPL LADDPEAFAELK KEIKNGRLAMFSMFGFFV
Sbjct:   11 GRVSMRKTASKTVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFGEASWFKAGSQIFSEGGLDYLGNQSLIHAQSILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLALADDPEAFAELKVKEIKNGRLAMFSMFGFFV 209          
The following BLAST results are available for this feature:
BLAST of CX671278 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 83
Match NameE-valueIdentityDescription
CB2A_SPIOL1.140e-11188.94Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB23_SOYBN1.944e-11190.23Chlorophyll a-b binding protein 3, chloroplastic O... [more]
CB24_PETSP2.539e-11188.13Chlorophyll a-b binding protein 25, chloroplastic ... [more]
CB23_NICPL4.331e-11186.76Chlorophyll a-b binding protein C, chloroplastic O... [more]
CB23_PETSP2.807e-11086.30Chlorophyll a-b binding protein 22R, chloroplastic... [more]
CB22_PETSP8.168e-11085.39Chlorophyll a-b binding protein 22L, chloroplastic... [more]
CB21_PETSP1.393e-10986.30Chlorophyll a-b binding protein 13, chloroplastic ... [more]
CB29_MAIZE5.854e-10885.91Chlorophyll a-b binding protein M9, chloroplastic ... [more]
CB22_MAIZE9.985e-10886.36Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB21_SOYBN9.985e-10893.47Chlorophyll a-b binding protein, chloroplastic (Fr... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS10_10A12_g Madame Vinous Sweet Orange Multiple Pathogen-Infected cDNA Library UCRCS10 Citrus sinensis cDNA clone UCRCS10-10A12-A24-5.g, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX671278 ID=CX671278|Name=CX671278|organism=Citrus sinensis|type=EST|length=716bp
CACAGCTTCTGCTTCTCAATTAAATTCCTCAATGGCAACCTCGACCATGG
CTCTCTCCTCATCATTCGTCGGCAAGGCTGTGAACCTTGCCCCTTCAGGC
AATGAGCTGAGCAATGGTGGCCGCATCTCCATGCGTAAAACCGGGAGCAA
GTCTGTTTCTTCAGGTAGCCCGTGGTACGGCCCGGACAGAGTCAAGTACT
TGGGCCCACTCTCTGGCGAGCCCCCAAGCTACTTGACTGGTGAGTTCCCT
GGTGACTACGGTTGGGACACTGCTGGGCTTTCAGCTGACCCAGAAACCTT
TGCCAAGAACCGTGAACTCGAAGTCATCCACTGCAGATGGGCCATGTTGG
GAGCTCTTGGATGCGTCTTCCCGGAGCTCTTGGCCCGCAACGGAGTCAAG
TTCGGTGAGGCCGTGTGGTTCAAGGCGGGGGCCCAGATCTTCAGCGAGGG
CGGGCTTGACTACTTGGGGAACCCAAGCCTGATCCACGCTCAGAGCATCT
TGGCCATCTGGGCTTGCCAGGTGGTCTTGATGGGAGCCGTTGAGGGTTAC
AGAATTGCTGGAGGGCCGCTCGGTGAAGTGACTGACCCATTGTACCCAGG
TGGCAGCTTTGATCCATTGGGTTTGGCTGATGACCCGGAGGCTTTTGCTG
AGCTCAAGGGTAAGGAAATCAAGAATGGAAGGTTGGCTATGTTCTCCATG
TTTGGTTTCTTCGTTC
back to top